RegulonDB RegulonDB 10.9: Gene Form
   

galU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rssB galU hns DsrA TSS_1572 (cluster) TSS_1572 (cluster) TSS_1571 TSS_1571 TSS_1570 TSS_1570 TSS_1569 TSS_1569 TSS_1568 TSS_1568 TSS_1567 TSS_1567 TSS_1566 TSS_1566 TSS_1565 (cluster) TSS_1565 (cluster) galUp galUp TSS_1563 (cluster) TSS_1563 (cluster) TSS_1562 TSS_1562

Gene      
Name: galU    Texpresso search in the literature
Synonym(s): ECK1231, EG11319, b1236, ychD
Genome position(nucleotides): 1291457 --> 1292365 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.97
External database links:  
ASAP:
ABE-0004150
CGSC:
719
ECHOBASE:
EB1295
ECOLIHUB:
galU
OU-MICROARRAY:
b1236
STRING:
511145.b1236
COLOMBOS: galU


Product      
Name: UTP—glucose-1-phosphate uridylyltransferase
Synonym(s): GalU, YchD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.942
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
10 -> 276 KAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGVVDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQLTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAF
2 -> 302 AAINTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGVVDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQLTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEEEMGIKK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.7 - galactose metabolism
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.9 - misc. glucose metabolism
  5 - cell processes --> 5.5 - adaptations --> 5.5.5 - dessication
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0016779 - nucleotidyltransferase activity
GO:0016740 - transferase activity
GO:0003983 - UTP:glucose-1-phosphate uridylyltransferase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
biological_process GO:0009058 - biosynthetic process
GO:0009242 - colanic acid biosynthetic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
GO:0006011 - UDP-glucose metabolic process
GO:0033499 - galactose catabolic process via UDP-galactose
GO:1900727 - osmoregulated periplasmic glucan biosynthetic process
External database links:  
DIP:
DIP-35950N
ECOCYC:
GLUC1PURIDYLTRANS-MONOMER
ECOLIWIKI:
b1236
INTERPRO:
IPR005835
INTERPRO:
IPR029044
INTERPRO:
IPR005771
PANTHER:
PTHR43197
PDB:
2E3D
PFAM:
PF00483
PRIDE:
P0AEP3
REFSEQ:
NP_415752
SMR:
P0AEP3
SWISSMODEL:
P0AEP3
UNIPROT:
P0AEP3


Operon      
Name: galU         
Operon arrangement:
Transcription unit        Promoter
galU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1562 1291321 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1563 (cluster) 1291343 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1565 (cluster) 1291414 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1566 1291421 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1567 1291580 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1568 1291585 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1569 1292735 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1570 1292806 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1571 1292820 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1572 (cluster) 1292827 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB