RegulonDB RegulonDB 10.8: Gene Form
   

emrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: emrA    Texpresso search in the literature
Synonym(s): ECK2679, EG11354, b2685
Genome position(nucleotides): 2811427 --> 2812599 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.37
External database links:  
ASAP:
ABE-0008838
CGSC:
33259
ECHOBASE:
EB1329
OU-MICROARRAY:
b2685
PortEco:
emrA
STRING:
511145.b2685
COLOMBOS: emrA


Product      
Name: multidrug efflux pump membrane fusion protein EmrA
Synonym(s): EmrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 42.736
Isoelectric point: 9.867
Motif(s):
 
Type Positions Sequence
35 -> 345 AVAIGIYWFLVLRHFEETDDAYVAGNQIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQLMINSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQYNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIISPMTGYVSRRAVQPGAQISPTTPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKVVGLDMGTGSAFSLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLSTLVSV
62 -> 62 I
25 -> 45 LLLTLLFIIIAVAIGIYWFLV
138 -> 138 K
61 -> 289 QIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQLMINSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQYNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIISPMTGYVSRRAVQPGAQISPTTPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0031226 - intrinsic component of plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:1990281 - efflux pump complex
molecular_function GO:0015125 - bile acid transmembrane transporter activity
GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0042910 - xenobiotic transmembrane transporter activity
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0048545 - response to steroid hormone
GO:0009636 - response to toxic substance
GO:0046677 - response to antibiotic
GO:0055085 - transmembrane transport
GO:0015721 - bile acid and bile salt transport
Note(s): Note(s): ...[more].
Reference(s): [1] Griffith JM., et al., 2019
[2] Hinchliffe P., et al., 2014
[3] Pu Y., et al., 2016
External database links:  
DIP:
DIP-9502N
ECOCYC:
EG11354-MONOMER
ECOLIWIKI:
b2685
INTERPRO:
IPR006143
INTERPRO:
IPR032317
INTERPRO:
IPR005694
MODBASE:
P27303
PFAM:
PF00529
PFAM:
PF16576
PRIDE:
P27303
PRODB:
PRO_000022509
PROSITE:
PS00543
REFSEQ:
NP_417170
SMR:
P27303
UNIPROT:
P27303


Operon      
Name: mprA-emrAB         
Operon arrangement:
Transcription unit        Promoter
emrRAB


Transcriptional Regulation      
Display Regulation             
Repressed by: MprA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2996 2811338 forward nd [RS-EPT-CBR] [4]



RegulonDB