RegulonDB RegulonDB 10.9: Gene Form
   

rlmM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmM gcvA fucR ygdD ygdDp2 ygdDp2 TSS_3116 TSS_3116

Gene      
Name: rlmM    Texpresso search in the literature
Synonym(s): ECK2801, EG11794, b2806, ygdE
Genome position(nucleotides): 2940143 <-- 2941243 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
Reference(s): [1] Bujnicki JM., et al., 2000
External database links:  
ASAP:
ABE-0009197
ECHOBASE:
EB1742
ECOLIHUB:
rlmM
OU-MICROARRAY:
b2806
STRING:
511145.b2806
COLOMBOS: rlmM


Product      
Name: 23S rRNA 2'-O-ribose C2498 methyltransferase
Synonym(s): RlmM, YgdE, ribosomal RNA large subunit methyltransferase M
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.905
Isoelectric point: 7.41
Motif(s):
 
Type Positions Sequence
1 -> 71 MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWF
221 -> 224 CPGG
186 -> 279 SRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0008757 - S-adenosylmethionine-dependent methyltransferase activity
GO:0070677 - rRNA (cytosine-2'-O-)-methyltransferase activity
biological_process GO:0006364 - rRNA processing
GO:0032259 - methylation
GO:0000453 - enzyme-directed rRNA 2'-O-methylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11794-MONOMER
ECOLIWIKI:
b2806
INTERPRO:
IPR029063
INTERPRO:
IPR040739
INTERPRO:
IPR011224
INTERPRO:
IPR002877
PDB:
4B17
PDB:
4AUK
PDB:
4ATN
PFAM:
PF18125
PFAM:
PF01728
PRIDE:
P0ADR6
PRODB:
PRO_000023773
REFSEQ:
NP_417286
SMR:
P0ADR6
UNIPROT:
P0ADR6


Operon      
Name: rlmM         
Operon arrangement:
Transcription unit        Promoter
rlmM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3116 2941109 reverse nd [RS-EPT-CBR] [2]
  promoter ygdDp2 2941721 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bujnicki JM., Rychlewski L., 2000, Prediction of a novel RNA 2'-O-ribose methyltransferase subfamily encoded by the Escherichia coli YgdE open reading frame and its orthologs., Acta Microbiol Pol 49(3-4):253-60

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB