RegulonDB RegulonDB 10.9: Gene Form
   

hybE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hybC hybD hybE hybF hybG hybB TSS_3306 TSS_3306

Gene      
Name: hybE    Texpresso search in the literature
Synonym(s): ECK2986, EG11803, b2992
Genome position(nucleotides): 3140311 <-- 3140799 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.4
External database links:  
ASAP:
ABE-0009824
CGSC:
33424
ECHOBASE:
EB1751
ECOLIHUB:
hybE
OU-MICROARRAY:
b2992
STRING:
511145.b2992
COLOMBOS: hybE


Product      
Name: hydrogenase 2-specific chaperone
Synonym(s): HybE
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 17.964
Isoelectric point: 5.169
Motif(s):
 
Type Positions Sequence
7 -> 7 G
12 -> 155 PKAQVQAAFEEIARRSMHDLSFLHPSMPVYVSDFTLFEGQWTGCVITPWMLSAVIFPGPDQLWPLRKVSEKIGLQLPYGTMTFTVGELDGVSQYLSCSLMSPLSHSMSIEEGQRLTDDCARMILSLPVTNPDVPHAGRRALLFG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
GO:0070678 - preprotein binding
biological_process GO:0051604 - protein maturation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Jack RL., et al., 2004
External database links:  
DIP:
DIP-35795N
ECOCYC:
EG11803-MONOMER
ECOLIWIKI:
b2992
INTERPRO:
IPR038530
INTERPRO:
IPR023994
MINT:
P0AAN1
PDB:
2KC5
PFAM:
PF11939
PRIDE:
P0AAN1
PRODB:
PRO_000022951
REFSEQ:
NP_417466
SMR:
P0AAN1
UNIPROT:
P0AAN1


Operon      
Name: hybOABCDEFG         
Operon arrangement:
Transcription unit        Promoter
hybOABCDEFG


Transcriptional Regulation      
Display Regulation             
Repressed by: NarL, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3306 3141794 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jack RL., Buchanan G., Dubini A., Hatzixanthis K., Palmer T., Sargent F., 2004, Coordinating assembly and export of complex bacterial proteins., EMBO J 23(20):3962-72

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB