RegulonDB RegulonDB 10.9: Gene Form
   

hybF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hybD hybE hybF hybG

Gene      
Name: hybF    Texpresso search in the literature
Synonym(s): ECK2985, EG11804, b2991
Genome position(nucleotides): 3139977 <-- 3140318 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.97
External database links:  
ASAP:
ABE-0009818
CGSC:
33427
ECHOBASE:
EB1752
ECOLIHUB:
hybF
OU-MICROARRAY:
b2991
STRING:
511145.b2991
COLOMBOS: hybF


Product      
Name: hydrogenase maturation protein HybF
Synonym(s): HybF, protein involved with the maturation of hydrogenases 1 and 2
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.697
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
73 -> 73 C
92 -> 92 C
1 -> 112 MHELSLCQSAVEIIQRQAEQHDVKRVTAVWLEIGALSCVEESAVRFSFEIVCHGTVAQGCDLHIVYKPAQAWCWDCSQVVEIHQHDAQCPLCHGERLRVDTGDSLIVKSIEV
3 -> 3 E
89 -> 89 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016151 - nickel cation binding
GO:0008270 - zinc ion binding
biological_process GO:0006464 - cellular protein modification process
GO:0051604 - protein maturation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Hube M., et al., 2002
External database links:  
ECOCYC:
EG11804-MONOMER
ECOLIWIKI:
b2991
INTERPRO:
IPR020538
INTERPRO:
IPR039002
INTERPRO:
IPR000688
PANTHER:
PTHR34535
PFAM:
PF01155
PRIDE:
P0A703
PROSITE:
PS01249
REFSEQ:
NP_417465
SMR:
P0A703
UNIPROT:
P0A703


Operon      
Name: hybOABCDEFG         
Operon arrangement:
Transcription unit        Promoter
hybOABCDEFG


Transcriptional Regulation      
Display Regulation             
Repressed by: ArcA, NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Hube M., Blokesch M., Bock A., 2002, Network of hydrogenase maturation in Escherichia coli: role of accessory proteins HypA and HybF., J Bacteriol 184(14):3879-85


RegulonDB