RegulonDB RegulonDB 10.10: Gene Form
   

yjfC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aidB yjfC yjfM AidB Ada TSS_5053 TSS_5053 aidBp aidBp

Gene      
Name: yjfC    Texpresso search in the literature
Synonym(s): ECK4182, EG11812, b4186
Genome position(nucleotides): 4413028 --> 4414191 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.92
External database links:  
ASAP:
ABE-0013698
ECHOBASE:
EB1760
ECOLIHUB:
yjfC
OU-MICROARRAY:
b4186
STRING:
511145.b4186
COLOMBOS: yjfC


Product      
Name: putative acid—amine ligase YjfC
Synonym(s): YjfC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.02
Isoelectric point: 4.406
Motif(s):
 
Type Positions Sequence
372 -> 374 LIT
14 -> 385 QIAADNGFDFHIIDNEIYWDESRAYRFTLRQIEEQIEKPTAELHQMCLEVVDRAVKDEEILTQLAIPPLYWDVIAESWRARDPSLYGRMDFAWCGNAPVKLLEYNADTPTSLYESAYFQWLWLEDARRSGIIPRDADQYNAIQERLISRFSELYSREPFYFCCCQDTDEDRSTVLYLQDCAQQAGQESRFIYIEDLGLGVGGVLTDLDDNVIQRAFKLYPLEWMMRDDNGPLLRKRREQWVEPLWKSILSNKGLMPLLWRFFPGHPNLLASWFDGEKPQIAAGESYVRKPIYSREGGNVTIFDGKNNVVDHADGDYADEPMIYQAFQPLPRFGDSYTLIGSWIVDDEACGMGIREDNTLITKDTSRFVPHYI
101 -> 103 RMD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11812-MONOMER
ECOLIWIKI:
b4186
INTERPRO:
IPR016185
INTERPRO:
IPR005494
PFAM:
PF03738
PRIDE:
P33222
REFSEQ:
NP_418607
SMR:
P33222
UNIPROT:
P33222


Operon      
Name: yjfKLMC         
Operon arrangement:
Transcription unit        Promoter
yjfKLMC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5053 4415541 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB