RegulonDB RegulonDB 10.9: Gene Form
   

yiiS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yiiR uspD yiiS YdeO ppGpp yiiSp yiiSp

Gene      
Name: yiiS    Texpresso search in the literature
Synonym(s): ECK3914, EG11876, b3922
Genome position(nucleotides): 4112967 --> 4113266 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.33
External database links:  
ASAP:
ABE-0012813
ECHOBASE:
EB1822
ECOLIHUB:
yiiS
OU-MICROARRAY:
b3922
STRING:
511145.b3922
COLOMBOS: yiiS


Product      
Name: DUF406 domain-containing protein YiiS
Synonym(s): YiiS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.776
Isoelectric point: 4.291
Motif(s):
 
Type Positions Sequence
5 -> 96 VDKCSTKGCAIDIGTVIDNDNCTSKFSRFFATREEAESFMTKLKELAAATSSADEGASVAYKIKDLEGQVELDAAFTFSCQAEMIIFELSLR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Serres MH., et al., 2001
External database links:  
ECOCYC:
EG11876-MONOMER
ECOLIWIKI:
b3922
INTERPRO:
IPR035571
INTERPRO:
IPR005272
PANTHER:
PTHR38769
PDB:
2K3I
PFAM:
PF04175
PRIDE:
P32162
REFSEQ:
NP_418357
SMR:
P32162
UNIPROT:
P32162


Operon      
Name: yiiS-uspD         
Operon arrangement:
Transcription unit        Promoter
yiiS-uspD


Transcriptional Regulation      
Display Regulation             
Activated by: YdeO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035


RegulonDB