RegulonDB RegulonDB 10.9: Gene Form
   

napG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

napA napH napG napB napD

Gene      
Name: napG    Texpresso search in the literature
Synonym(s): ECK2197, EG12064, b2205, yojA, yojB
Genome position(nucleotides): 2299565 <-- 2300260 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
59.05
External database links:  
ASAP:
ABE-0007287
CGSC:
36553
ECHOBASE:
EB1993
ECOLIHUB:
napG
OU-MICROARRAY:
b2205
STRING:
511145.b2205
COLOMBOS: napG


Product      
Name: ferredoxin-type protein NapG
Synonym(s): NapG, YojA, YojB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 24.925
Isoelectric point: 8.009
Motif(s):
 
Type Positions Sequence
50 -> 81 GAINENAFASACVRCGQCVQACPYDTLKLATL
60 -> 115 ACVRCGQCVQACPYDTLKLATLASGLSAGTPYFVARDIPCEMCEDIPCAKVCPSGA
89 -> 121 TPYFVARDIPCEMCEDIPCAKVCPSGALDREIE
183 -> 196 SDACTGCGKCEKVC
1 -> 41 MSRSAKPQNGRRRFLRDVVRTAGGLAAVGVALGLQQQTARA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
NAPG-MONOMER
ECOLIWIKI:
b2205
INTERPRO:
IPR006311
INTERPRO:
IPR004494
INTERPRO:
IPR017900
INTERPRO:
IPR017896
MODBASE:
P0AAL3
PFAM:
PF12800
PFAM:
PF12838
PRIDE:
P0AAL3
PRODB:
PRO_000023349
PROSITE:
PS51379
PROSITE:
PS51318
PROSITE:
PS00198
REFSEQ:
NP_416709
SMR:
P0AAL3
UNIPROT:
P0AAL3


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ModE, FlhDC, NarP
Repressed by: IscR, NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB