RegulonDB RegulonDB 10.9: Gene Form
   

tktB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tktB ypfG talA tktBp tktBp TSS_2750 TSS_2750

Gene      
Name: tktB    Texpresso search in the literature
Synonym(s): ECK2460, EG12100, b2465
Genome position(nucleotides): 2579636 --> 2581639 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.64
External database links:  
ASAP:
ABE-0008117
CGSC:
29992
ECHOBASE:
EB2024
ECOLIHUB:
tktB
OU-MICROARRAY:
b2465
STRING:
511145.b2465
COLOMBOS: tktB


Product      
Name: transketolase 2
Synonym(s): TktB, transketolase II
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 73.043
Isoelectric point: 6.262
Motif(s):
 
Type Positions Sequence
3 -> 333 RKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLKHNPTDPTWYDRDRFILSNGHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEIGYTPGVETTTGPLGQGLANAVGLAIAERTLAAQFNQPDHEIVDHFTYVFMGDGCLMEGISHEVCSLAGTLGLGKLIGFYDHNGISIDGETEGWFTDDTAKRFEAYHWHVIHEIDGHDPQAVKEAILEAQSVKDKPSLIICRTVIGFGSPNKAGKEEAHGAPLGEEEVALARQKLGWHHPPFEIPKEIYHAWDAREKGEKAQQSWNEKFAAYKKAHPQLAEEFTRRMSGGLP
353 -> 523 KIATRKASQNTLNAYGPMLPELLGGSADLAPSNLTIWKGSVSLKEDPAGNYIHYGVREFGMTAIANGIAHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVYTHDSIGLGEDGPTHQAVEQLASLRLTPNFSTWRPCDQVEAAVGWKLAVERHNGPTALILSRQNLA
539 -> 654 GYVLKDSGGKPDIILIATGSEMEITLQAAEKLAGEGRNVRVVSLPSTDIFDAQDEEYRESVLPSNVAARVAVEAGIADYWYKYVGLKGAIVGMTGYGESAPADKLFPFFGFTAENI
113 -> 115 GPL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.3 - non-oxidative branch, pentose pathway
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0004802 - transketolase activity
biological_process GO:0009052 - pentose-phosphate shunt, non-oxidative branch
GO:0006098 - pentose-phosphate shunt
Note(s): Note(s): ...[more].
Reference(s): [1] Li RD., et al., 2012
External database links:  
DIP:
DIP-10999N
ECOCYC:
TRANSKETOII-MONOMER
ECOLIWIKI:
b2465
INTERPRO:
IPR020826
INTERPRO:
IPR033248
INTERPRO:
IPR033247
INTERPRO:
IPR029061
INTERPRO:
IPR009014
INTERPRO:
IPR005478
INTERPRO:
IPR005475
INTERPRO:
IPR005474
MODBASE:
P33570
PANTHER:
PTHR43522
PFAM:
PF02780
PFAM:
PF02779
PFAM:
PF00456
PRIDE:
P33570
PRODB:
PRO_000024073
PROSITE:
PS00801
PROSITE:
PS00802
REFSEQ:
NP_416960
SMART:
SM00861
SMR:
P33570
SWISSMODEL:
P33570
UNIPROT:
P33570


Operon      
Name: talA-tktB         
Operon arrangement:
Transcription unit        Promoter
talA-tktB
talA-tktB
talA
tktB


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2750 2578793 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Li RD., Liu L., 2012, Characterizing criticality of proteins by systems dynamics: Escherichia coli central carbon metabolism as a working example., BMC Syst Biol 6 Suppl 1:S11

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB