RegulonDB RegulonDB 10.9: Gene Form
   

ptsP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ptsP lgt rppH TSS_3131 TSS_3131 TSS_3130 TSS_3130 lgtp lgtp TSS_3129 TSS_3129 thyAp2 thyAp2 thyAp thyAp TSS_3128 (cluster) TSS_3128 (cluster)

Gene      
Name: ptsP    Texpresso search in the literature
Synonym(s): ECK2825, EG12188, b2829, ygdF, ygdO
Genome position(nucleotides): 2966188 <-- 2968434 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.89
External database links:  
ASAP:
ABE-0009274
ECHOBASE:
EB2105
ECOLIHUB:
ptsP
OU-MICROARRAY:
b2829
STRING:
511145.b2829
COLOMBOS: ptsP


Product      
Name: phosphoenolpyruvate-protein phosphotransferase PtsP
Synonym(s): EINtr, EInitrogen, PtsP, YgdF, YgdO, enzyme INtr
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 83.716
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
18 -> 152 LNEALNILVTDICLAMDTEVCSVYLADHDRRCYYLMATRGLKKPRGRTVTLAFDEGIVGLVGRLAEPINLADAQKHPSFKYIPSVKEERFRAFLGVPIIQRRQLLGVLVVQQRELRQYDESEESFLVTLATQMAA
128 -> 170 QQRELRQYDESEESFLVTLATQMAAILSQSQLTALFGQYRQTR
171 -> 748 IRALPAAPGVAIAEGWQDATLPLMEQVYQASTLDPALERERLTGALEEAANEFRRYSKRFAAGAQKETAAIFDLYSHLLSDTRLRRELFAEVDKGSVAEWAVKTVIEKFAEQFAALSDNYLKERAGDLRALGQRLLFHLDDANQGPNAWPERFILVADELSATTLAELPQDRLVGVVVRDGAANSHAAIMVRALGIPTVMGADIQPSVLHRRTLIVDGYRGELLVDPEPVLLQEYQRLISEEIELSRLAEDDVNLPAQLKSGERIKVMLNAGLSPEHEEKLGSRIDGIGLYRTEIPFMLQSGFPSEEEQVAQYQGMLQMFNDKPVTLRTLDVGADKQLPYMPISEENPCLGWRGIRITLDQPEIFLIQVRAMLRANAATGNLNILLPMVTSLDEVDEARRLIERAGREVEEMIGYEIPKPRIGIMLEVPSMVFMLPHLAKRVDFISVGTNDLTQYILAVDRNNTRVANIYDSLHPAMLRALAMIAREAEIHGIDLRLCGEMAGDPMCVAILIGLGYRHLSMNGRSVARAKYLLRRIDYAEAENLAQRSLEAQLATEVRHQVAAFMERRGMGGLIRGGL
620 -> 621 ND
1 -> 127 MLTRLREIVEKVASAPRLNEALNILVTDICLAMDTEVCSVYLADHDRRCYYLMATRGLKKPRGRTVTLAFDEGIVGLVGRLAEPINLADAQKHPSFKYIPSVKEERFRAFLGVPIIQRRQLLGVLVV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0008965 - phosphoenolpyruvate-protein phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0006468 - protein phosphorylation
GO:0016310 - phosphorylation
GO:0010243 - response to organonitrogen compound
Note(s): Note(s): ...[more].
Reference(s): [1] Gu P., et al., 2019
External database links:  
ECOCYC:
EG12188-MONOMER
ECOLIWIKI:
b2829
INTERPRO:
IPR023151
INTERPRO:
IPR040442
INTERPRO:
IPR036637
INTERPRO:
IPR036618
INTERPRO:
IPR029016
INTERPRO:
IPR018274
INTERPRO:
IPR015813
INTERPRO:
IPR008731
INTERPRO:
IPR008279
INTERPRO:
IPR006318
INTERPRO:
IPR003018
INTERPRO:
IPR000121
MODBASE:
P37177
PDB:
5T12
PDB:
5T1O
PFAM:
PF00391
PFAM:
PF01590
PFAM:
PF05524
PFAM:
PF02896
PRIDE:
P37177
PRODB:
PRO_000023636
PROSITE:
PS00370
PROSITE:
PS00742
REFSEQ:
NP_417306
SMART:
SM00065
SMR:
P37177
SWISSMODEL:
P37177
UNIPROT:
P37177


Operon      
Name: rppH-ptsP         
Operon arrangement:
Transcription unit        Promoter
rppH-ptsP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3128 (cluster) 2965245 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter thyAp2 2965348 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_3129 2966117 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3130 2967019 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3131 2967163 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gu P., Niu H., Fan X., Gao J., Li Q., 2019, Engineering of phosphoenolpyruvate: carbohydrate phosphotransferase system increased acetate assimilation in Escherichia coli., 3 Biotech 9(3):77

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB