RegulonDB RegulonDB 10.9: Gene Form
   

yegD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yegD    Texpresso search in the literature
Synonym(s): ECK2063, EG12200, b2069
Genome position(nucleotides): 2147674 --> 2149026 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.1
External database links:  
ASAP:
ABE-0006856
ECHOBASE:
EB2116
ECOLIHUB:
yegD
OU-MICROARRAY:
b2069
STRING:
511145.b2069
COLOMBOS: yegD


Product      
Name: HSP70 family protein YegD
Synonym(s): YegD, actin family protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.371
Isoelectric point: 4.876
Motif(s):
 
Type Positions Sequence
3 -> 228 IGFDYGTANCSVAVMRDGKPHLLKMENDSTLLPSMLCAPTREAVSEWLYRHHDVPADDDETQALLRRAIRYNREEDIDVTAKSVQFGLSSLAQYIDDPEEVWFVKSPKSFLGASGLKPQQVALFEDLVCAMMLHIRQQAQAQLPEAITQAVIGRPINFQGLGGDEANTQAQGILERAAKRAGFRDVVFQYEPVAAGLDYEATLQEEKRVLVVDIGGGTTDCSLLLM
330 -> 422 RQRLSYRLVRSAEECKIALSSVAETRASLPFISNELATLISQRGLESALSQPLTRILEQVQLALDNAQEKPDVIYLTGGSARSPLIKKALAEQ
145 -> 147 LPE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Itoh T., et al., 1999
External database links:  
ECOCYC:
EG12200-MONOMER
ECOLIWIKI:
b2069
INTERPRO:
IPR018181
INTERPRO:
IPR043129
INTERPRO:
IPR042054
INTERPRO:
IPR013126
MODBASE:
P36928
PANTHER:
PTHR19375
PFAM:
PF00012
PRIDE:
P36928
PROSITE:
PS00329
REFSEQ:
NP_416573
UNIPROT:
P36928


Operon      
Name: yegD         
Operon arrangement:
Transcription unit        Promoter
yegD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yegDp2 2147644 forward Similarity to the consensus
Read more >
[ICWHO] [2]



RegulonDB