RegulonDB RegulonDB 10.9: Gene Form
   

pepB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepB sseB iscX ryfA terminator TSS_2824 TSS_2824 TSS_2823 TSS_2823

Gene      
Name: pepB    Texpresso search in the literature
Synonym(s): ECK2520, EG12310, b2523, yfhI
Genome position(nucleotides): 2655075 <-- 2656358 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.85
External database links:  
ASAP:
ABE-0008305
ECHOBASE:
EB2216
ECOLIHUB:
pepB
OU-MICROARRAY:
b2523
STRING:
511145.b2523
COLOMBOS: pepB


Product      
Name: aminopeptidase B
Synonym(s): PepB, YfhI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.18
Isoelectric point: 5.703
Motif(s):
 
Type Positions Sequence
155 -> 155 Q
5 -> 81 MKITLSTQPADARWGEKATYSINNDGITLHLNGADDLGLIQRAARKIDGLGIKHVQLSGEGWDADRCWAFWQGYKAP
375 -> 427 STAAGFLSHFVENYQQGWLHIDCSATYRKAPVEQWSAGATGLGVRTIANLLTA
109 -> 421 WVRDTINAPAEELGPSQLAQRAVDLISNVAGDRVTYRITKGEDLREQGYMGLHTVGRGSERSPVLLALDYNPTGDKEAPVYACLVGKGITFDSGGYSIKQTAFMDSMKSDMGGAATVTGALAFAITRGLNKRVKLFLCCADNLISGNAFKLGDIITYRNGKKVEVMNTDAEGRLVLADGLIDASAQKPEMIIDAATLTGAAKTALGNDYHALFSFDDALAGRLLASAAQENEPFWRLPLAEFHRSQLPSNFAELNNTGSAAYPAGASTAAGFLSHFVENYQQGWLHIDCSATYRKAPVEQWSAGATGLGVRTI
41 -> 41 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004177 - aminopeptidase activity
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
GO:0070006 - metalloaminopeptidase activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006508 - proteolysis
GO:0019538 - protein metabolic process
GO:0043171 - peptide catabolic process
External database links:  
DIP:
DIP-10455N
ECOCYC:
EG12310-MONOMER
ECOLIWIKI:
b2523
INTERPRO:
IPR011356
INTERPRO:
IPR008330
INTERPRO:
IPR001346
INTERPRO:
IPR000819
MODBASE:
P37095
PANTHER:
PTHR11963:SF20
PANTHER:
PTHR11963
PDB:
6OAD
PDB:
6OV8
PFAM:
PF00883
PFAM:
PF12404
PRIDE:
P37095
PRINTS:
PR00481
PRODB:
PRO_000023508
PROSITE:
PS00631
REFSEQ:
NP_417018
SMR:
P37095
UNIPROT:
P37095


Operon      
Name: pepB         
Operon arrangement:
Transcription unit        Promoter
pepB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2823 2656567 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2824 2656727 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB