RegulonDB RegulonDB 10.9: Gene Form
   

zapD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zapD coaE yacG b0100 yacM TSS_229 TSS_229 TSS_228 TSS_228 TSS_227 TSS_227 TSS_226 TSS_226 TSS_225 TSS_225 TSS_224 TSS_224 TSS_223 TSS_223 TSS_222 TSS_222

Gene      
Name: zapD    Texpresso search in the literature
Synonym(s): ECK0102, EG12313, b0102, yacF
Genome position(nucleotides): 111856 <-- 112599 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.48
External database links:  
ASAP:
ABE-0000355
ECHOBASE:
EB2219
ECOLIHUB:
yacF
OU-MICROARRAY:
b0102
STRING:
511145.b0102
COLOMBOS: zapD


Product      
Name: cell division factor ZapD
Synonym(s): YacF, ZapD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.292
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
19 -> 225 LRIEFLIQQLTVNLPIVDHAGALHFFRNVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLISAPRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIASLNPLTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRFAIR
215 -> 215 I

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0090529 - cell septum assembly
External database links:  
ECOCYC:
EG12313-MONOMER
ECOLIWIKI:
b0102
INTERPRO:
IPR036268
INTERPRO:
IPR009777
INTERPRO:
IPR027462
PANTHER:
PTHR39455
PDB:
5DKO
PDB:
5IMJ
PDB:
5KOA
PFAM:
PF07072
PRIDE:
P36680
REFSEQ:
NP_414644
SMR:
P36680
UNIPROT:
P36680


Operon      
Name: coaE-zapD-yacG         
Operon arrangement:
Transcription unit        Promoter
yacG
coaE-zapD-yacG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_222 112251 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_223 112273 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_224 112599 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_225 112607 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_226 112609 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_227 112617 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_228 112696 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_229 112703 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB