RegulonDB RegulonDB 10.9: Gene Form
   

yagB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yagA yagB insAB2 insA2 insX insI2 insB2 TSS_469 TSS_469 TSS_468 TSS_468 TSS_467 (cluster) TSS_467 (cluster)

Gene      
Name: yagB    Texpresso search in the literature
Synonym(s): ECK0267, EG12339, b0266
Genome position(nucleotides): 280385 <-- 280735 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.0
External database links:  
ASAP:
ABE-0000912
ECHOBASE:
EB2243
ECOLIHUB:
yagB
ECOO157CYC:
Z1220
ECOO157CYC:
Z1658
OU-MICROARRAY:
b0266
STRING:
316407.85674410
COLOMBOS: yagB


Product      
Name: CP4-6 prophage; orphan antitoxin YagB
Synonym(s): CP4-6 prophage; putative cytoskeleton-binding protein YagB, YagB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.184
Isoelectric point: 7.673
Motif(s):
 
Type Positions Sequence
7 -> 105 QTWGLKRDITPCFGARLVQEGHRLHFLADRAGFTGSFSEVQTLQLDEAFPHFVAHLELMLLSCELNPRYAHCVTLYRNGLTGEADTLGSHGYVYIAILN

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0051495 - positive regulation of cytoskeleton organization
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12339-MONOMER
ECOLIWIKI:
b0266
ECOO157CYC:
Z1220-MONOMER
ECOO157CYC:
Z1658-MONOMER
INTERPRO:
IPR038025
INTERPRO:
IPR009320
PFAM:
PF06154
PRIDE:
P37008
REFSEQ:
NP_414800
SMR:
P37008
UNIPROT:
P37008


Operon      
Name: yagAB-insX         
Operon arrangement:
Transcription unit        Promoter
yagAB-insX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_467 (cluster) 279709 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_468 279891 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_469 279893 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB