RegulonDB RegulonDB 10.9: Gene Form
   

yedJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcm yedJ yedR vsr terminator TSS_2277 TSS_2277 yedJp4 yedJp4 yedJp3 yedJp3 TSS_2276 TSS_2276

Gene      
Name: yedJ    Texpresso search in the literature
Synonym(s): ECK1960, EG12710, b1962
Genome position(nucleotides): 2032384 <-- 2033079 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.45
External database links:  
ASAP:
ABE-0006512
ECHOBASE:
EB2572
ECOLIHUB:
yedJ
OU-MICROARRAY:
b1962
STRING:
511145.b1962
COLOMBOS: yedJ


Product      
Name: putative HD superfamily phosphohydrolase YedJ
Synonym(s): YedJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.904
Isoelectric point: 6.338
Motif(s):
 
Type Positions Sequence
29 -> 131 HFRRVWATAQKLAADDDVDMLVILTACYFHDIVSLAKNHPQRQRSSILAAEETRRLLREEFEQFPAEKIEAVCHAIAAHSFSAQIAPLTTEAKIVQDADRLEA
26 -> 132 DVCHFRRVWATAQKLAADDDVDMLVILTACYFHDIVSLAKNHPQRQRSSILAAEETRRLLREEFEQFPAEKIEAVCHAIAAHSFSAQIAPLTTEAKIVQDADRLEAL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12710-MONOMER
ECOLIWIKI:
b1962
INTERPRO:
IPR003607
INTERPRO:
IPR006674
PDB:
3GW7
PFAM:
PF01966
PRIDE:
P46144
PROSITE:
PS51831
REFSEQ:
NP_416471
SMART:
SM00471
SMR:
P46144
UNIPROT:
P46144


Operon      
Name: drpB-yedJ         
Operon arrangement:
Transcription unit        Promoter
yedRJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2276 2031452 reverse nd [RS-EPT-CBR] [1]
  promoter yedJp3 2033203 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yedJp4 2033223 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB