RegulonDB RegulonDB 10.9: Gene Form
   

frmR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

frmA yaiO frmR

Gene      
Name: frmR    Texpresso search in the literature
Synonym(s): ECK0354, G6209, b0357, yaiN
Genome position(nucleotides): 379606 <-- 379881 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.26
External database links:  
ASAP:
ABE-0001226
ECHOBASE:
EB3081
ECOLIHUB:
frmR
OU-MICROARRAY:
b0357
STRING:
511145.b0357
COLOMBOS: frmR


Product      
Name: DNA-binding transcriptional repressor FrmR
Synonym(s): FrmR, YaiN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.318
Isoelectric point: 5.919
Motif(s):
 
Type Positions Sequence
7 -> 87 EKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.5 - action unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
External database links:  
DIP:
DIP-48245N
ECOCYC:
G6209-MONOMER
ECOLIWIKI:
b0357
INTERPRO:
IPR003735
INTERPRO:
IPR038390
PANTHER:
PTHR33677
PDB:
5LBM
PFAM:
PF02583
PRIDE:
P0AAP3
PRODB:
PRO_000022696
REFSEQ:
NP_414891
SMR:
P0AAP3
UNIPROT:
P0AAP3


Operon      
Name: frmRAB         
Operon arrangement:
Transcription unit        Promoter
frmRAB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB