RegulonDB RegulonDB 10.9: Gene Form
   

borD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybcV borD rzpD rzoD PhoP borDp borDp

Gene      
Name: borD    Texpresso search in the literature
Synonym(s): ECK0549, G6312, b0557, bor, iss, vboR, ybcU
Genome position(nucleotides): 578600 <-- 578893 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.5
External database links:  
ASAP:
ABE-0001902
ECHOBASE:
EB3401
ECOLIHUB:
borD
OU-MICROARRAY:
b0557
STRING:
511145.b0557
COLOMBOS: borD


Product      
Name: DLP12 prophage; prophage lipoprotein BorD
Synonym(s): Bor, BorD, Iss, VboR, YbcU, lipoprotein bor homolog from lambdoid prophage DLP12
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 10.447
Isoelectric point: 9.706
Motif(s):
 
Type Positions Sequence
19 -> 95 QQTFTVQNKQTAVAPKETITHHFFVSGIGQKKTVDAAKICGGAENVVKTETQQTFVNGLLGFITLGIYTPLEARVYC
17 -> 97 CAQQTFTVQNKQTAVAPKETITHHFFVSGIGQKKTVDAAKICGGAENVVKTETQQTFVNGLLGFITLGIYTPLEARVYCSK
1 -> 16 MKKMLLATALALLITG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031225 - anchored component of membrane
biological_process GO:0071286 - cellular response to magnesium ion
Note(s): Note(s): ...[more].
Reference(s): [1] Tenorio E., et al., 2003
External database links:  
ECOCYC:
G6312-MONOMER
ECOLIWIKI:
b0557
INTERPRO:
IPR010438
PFAM:
PF06291
PRIDE:
P77330
PROSITE:
PS51257
REFSEQ:
NP_415089
UNIPROT:
P77330


Operon      
Name: borD         
Operon arrangement:
Transcription unit        Promoter
borD


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Tenorio E., Saeki T., Fujita K., Kitakawa M., Baba T., Mori H., Isono K., 2003, Systematic characterization of Escherichia coli genes/ORFs affecting biofilm formation., FEMS Microbiol Lett 225(1):107-14


RegulonDB