RegulonDB RegulonDB 10.9: Gene Form
   

ybcV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybcV borD ybcW PhoP ybcWp7 ybcWp7 ybcWp4 ybcWp4 borDp borDp

Gene      
Name: ybcV    Texpresso search in the literature
Synonym(s): ECK0550, G6313, b0558
Genome position(nucleotides): 579184 <-- 579594 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
31.63
External database links:  
ASAP:
ABE-0001907
ECHOBASE:
EB3402
ECOLIHUB:
ybcV
OU-MICROARRAY:
b0558
STRING:
511145.b0558
COLOMBOS: ybcV


Product      
Name: DLP12 prophage; DUF1398 domain-containing protein YbcV
Synonym(s): YbcV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.414
Isoelectric point: 9.487
Motif(s):
 
Type Positions Sequence
8 -> 125 KEIFDQVRKDLNCELFYSELKRHNVSHYIYYLATDNIHIVLENDNTVLIKGLKKVVNVKFSRNTHLIETSYDRLKSREITFQQYRENLAKAGVFRWITNIHEHKRYYYTFDNSLLFTE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11339N
ECOCYC:
G6313-MONOMER
ECOLIWIKI:
b0558
INTERPRO:
IPR009833
INTERPRO:
IPR036696
PFAM:
PF07166
PRIDE:
P77598
REFSEQ:
NP_415090
SMR:
P77598
UNIPROT:
P77598


Operon      
Name: ybcV         
Operon arrangement:
Transcription unit        Promoter
ybcV


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybcWp4 579805 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybcWp7 579844 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB