RegulonDB RegulonDB 10.9: Gene Form
   

modE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

modF modE acrZ SoxS Rob MarA anti-anti-terminator anti-terminator anti-terminator terminator acrZp acrZp

Gene      
Name: modE    Texpresso search in the literature
Synonym(s): ECK0750, G6395, b0761, chlD, modR
Genome position(nucleotides): 793856 <-- 794644 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.6
External database links:  
ASAP:
ABE-0002585
ECHOBASE:
EB3017
ECOLIHUB:
modE
OU-MICROARRAY:
b0761
STRING:
511145.b0761
COLOMBOS: modE


Product      
Name: DNA-binding transcriptional dual regulator ModE
Synonym(s): ChlD, ModE, ModE-MoO42-, ModR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 28.281
Isoelectric point: 5.08
Motif(s):
 
Type Positions Sequence
1 -> 121 MQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINEMNQLSEHILVERATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLSDDDALPLNSLLAAISRF
33 -> 79 SISQGAKDAGISYKSAWDAINEMNQLSEHILVERATGGKGGGGAVLT
124 -> 191 QTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQ
133 -> 133 G
76 -> 76 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.4 - molybdenum
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
GO:0003700 - DNA-binding transcription factor activity
GO:0030151 - molybdenum ion binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0015689 - molybdate ion transport
GO:2000143 - negative regulation of DNA-templated transcription, initiation
External database links:  
DIP:
DIP-10238N
ECOCYC:
MONOMER0-185
ECOLIWIKI:
b0761
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR016462
INTERPRO:
IPR008995
INTERPRO:
IPR005116
INTERPRO:
IPR004606
INTERPRO:
IPR003725
INTERPRO:
IPR000847
MODBASE:
P0A9G8
PDB:
1H9R
PDB:
1H9S
PDB:
1O7L
PDB:
1B9M
PDB:
1B9N
PFAM:
PF03459
PFAM:
PF00126
PRIDE:
P0A9G8
PRODB:
PRO_000023270
PROSITE:
PS51866
REFSEQ:
NP_415282
SMR:
P0A9G8
UNIPROT:
P0A9G8


Operon      
Name: modEF         
Operon arrangement:
Transcription unit        Promoter
modEF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB