RegulonDB RegulonDB 10.9: Gene Form
   

cspH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB4 insB4 cspH cspG insA4 YjjQ YjjQ Cis-reg; thermoregulator anti-anti-terminator anti-terminator terminator terminator cspHp13 cspHp13 cspHp9 cspHp9 cspHp15 cspHp15 cspGp cspGp cspHp14 cspHp14 cspHp12 cspHp12 cspHp10 cspHp10 cspHp8 cspHp8 gfcAp gfcAp TSS_1309 (cluster) TSS_1309 (cluster)

Gene      
Name: cspH    Texpresso search in the literature
Synonym(s): ECK0979, G6510, b0989, cspK
Genome position(nucleotides): 1050963 <-- 1051175 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.95
External database links:  
ASAP:
ABE-0003341
ECHOBASE:
EB4029
ECOLIHUB:
cspH
OU-MICROARRAY:
b0989
STRING:
511145.b0989
COLOMBOS: cspH


Product      
Name: CspA family protein CspH
Synonym(s): CspH, CspK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.72
Isoelectric point: 10.95
Motif(s):
 
Type Positions Sequence
7 -> 67 GIVKTFDRKSGKGFIIPSDGRKEVQVHISAFTPRDAEVLIPGLRVEFCRVNGLRGPTAANV
5 -> 69 MTGIVKTFDRKSGKGFIIPSDGRKEVQVHISAFTPRDAEVLIPGLRVEFCRVNGLRGPTAANVYL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0003723 - RNA binding
GO:0001072 - transcription antitermination factor activity, RNA binding
biological_process GO:0031564 - transcription antitermination
GO:0010468 - regulation of gene expression
GO:0060567 - negative regulation of DNA-templated transcription, termination
Note(s): Note(s): ...[more].
Reference(s): [1] Higuchi K., et al., 2020
[2] Kram KE., et al., 2020
[3] Nahku R., et al., 2011
External database links:  
ECOCYC:
G6510-MONOMER
ECOLIWIKI:
b0989
INTERPRO:
IPR011129
INTERPRO:
IPR019844
INTERPRO:
IPR002059
INTERPRO:
IPR012156
INTERPRO:
IPR012340
MODBASE:
P0A982
PFAM:
PF00313
PRIDE:
P0A982
PROSITE:
PS00352
PROSITE:
PS51857
REFSEQ:
NP_415509
SMART:
SM00357
SMR:
P0A982
SWISSMODEL:
P0A982
UNIPROT:
P0A982


Operon      
Name: cspH         
Operon arrangement:
Transcription unit        Promoter
cspH


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1309 (cluster) 1050701 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter cspHp8 1051205 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter cspHp10 1051278 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter cspHp12 1051284 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter cspHp14 1051304 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter cspGp 1051305 forward nd [AIPP], [RS-EPT-CBR] [4], [6]
  promoter cspHp15 1051307 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter cspHp9 1051330 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter cspHp13 1051373 reverse Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Higuchi K., Yabuki T., Ito M., Kigawa T., 2020, Cold shock proteins improve E. coli cell-free synthesis in terms of soluble yields of aggregation-prone proteins., Biotechnol Bioeng 117(6):1628-1639

 [2] Kram KE., Henderson AL., Finkel SE., 2020, Escherichia coli Has a Unique Transcriptional Program in Long-Term Stationary Phase Allowing Identification of Genes Important for Survival., mSystems 5(4)

 [3] Nahku R., Peebo K., Valgepea K., Barrick JE., Adamberg K., Vilu R., 2011, Stock culture heterogeneity rather than new mutational variation complicates short-term cell physiology studies of Escherichia coli K-12 MG1655 in continuous culture., Microbiology 157(Pt 9):2604-2610

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [6] Wang N., Yamanaka K., Inouye M., 1999, CspI, the ninth member of the CspA family of Escherichia coli, is induced upon cold shock., J Bacteriol 181(5):1603-9


RegulonDB