RegulonDB RegulonDB 10.9: Gene Form
   

rutD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rutD rutE rutC

Gene      
Name: rutD    Texpresso search in the literature
Synonym(s): ECK1000, G6520, b1009, ycdJ
Genome position(nucleotides): 1070965 <-- 1071765 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.93
External database links:  
ASAP:
ABE-0003410
ECHOBASE:
EB3616
ECOLIHUB:
rutD
OU-MICROARRAY:
b1009
STRING:
511145.b1009
COLOMBOS: rutD


Product      
Name: putative aminoacrylate hydrolase RutD
Synonym(s): RutD, YcdJ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 28.898
Isoelectric point: 6.275
Motif(s):
 
Type Positions Sequence
16 -> 249 VVLISGLGGSGSYWLPQLAVLEQEYQVVCYDQRGTGNNPDTLAEDYSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLALDYPASVTVLISVNGWLRINAHTRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAARAPRLEAEDALALAHFQGKNNLLRRLNALKRADFSHHADRIRCPVQIICASDDLLVPTACSSELHAALPDSQKMVMPYGGHACNVTDPETFNA
14 -> 115 PVVVLISGLGGSGSYWLPQLAVLEQEYQVVCYDQRGTGNNPDTLAEDYSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLALDYPASVTVLISVNGWL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
molecular_function GO:0016787 - hydrolase activity
GO:0016811 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0042803 - protein homodimerization activity
biological_process GO:0006208 - pyrimidine nucleobase catabolic process
GO:0019740 - nitrogen utilization
GO:0006212 - uracil catabolic process
External database links:  
ECOCYC:
G6520-MONOMER
ECOLIWIKI:
b1009
INTERPRO:
IPR019913
INTERPRO:
IPR029058
INTERPRO:
IPR000073
MODBASE:
P75895
PFAM:
PF12697
PRIDE:
P75895
PRINTS:
PR00111
PRODB:
PRO_000023898
REFSEQ:
NP_415529
SMR:
P75895
UNIPROT:
P75895


Operon      
Name: rutABCDEFG         
Operon arrangement:
Transcription unit        Promoter
rutABCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP, NtrC, ArcA
Repressed by: RutR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB