RegulonDB RegulonDB 10.10: Gene Form
   

clsC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

clsC opgC ymdB clsCp clsCp

Gene      
Name: clsC    Texpresso search in the literature
Synonym(s): ECK1032, G6551, b1046, ymdC
Genome position(nucleotides): 1106355 --> 1107776 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.7
External database links:  
ASAP:
ABE-0003551
ECHOBASE:
EB3634
ECOLIHUB:
ymdC
OU-MICROARRAY:
b1046
STRING:
511145.b1046
COLOMBOS: clsC


Product      
Name: cardiolipin synthase C
Synonym(s): ClsC, YmdC, cardiolipin synthase 3
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 53.666
Isoelectric point: 9.458
Motif(s):
 
Type Positions Sequence
125 -> 152 LNRRMHNKSFTVDGVVTLVGGRNIGDAY
274 -> 417 IMGSPSERIDIISSYFVPTRAGVAQLLRMVRKGVKIAILTNSLAANDVAVVHAGYARWRKKLLRYGVELYELKPTREQSSTLHDRGITGNSGASLHAKTFSIDGKTVFIGSFNFDPRSTLLNTEMGFVIESETLAQLIDKRFIQ
369 -> 369 H
130 -> 130 H
364 -> 391 SGASLHAKTFSIDGKTVFIGSFNFDPRS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
GO:0090483 - phosphatidylglycerol-phosphatidylethanolamine phosphatidyltransferase activity
biological_process GO:0006629 - lipid metabolic process
GO:0008654 - phospholipid biosynthetic process
GO:0032049 - cardiolipin biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Douglass MV., et al., 2021
[2] Qiu N., et al., 2019
[3] Rathmann C., et al., 2017
External database links:  
DIP:
DIP-12712N
ECOCYC:
G6551-MONOMER
ECOLIWIKI:
b1046
INTERPRO:
IPR030871
INTERPRO:
IPR025202
INTERPRO:
IPR001736
MODBASE:
P75919
PFAM:
PF13091
PRIDE:
P75919
PROSITE:
PS50035
REFSEQ:
NP_415564
SMART:
SM00155
UNIPROT:
P75919


Operon      
Name: ymdAB-clsC         
Operon arrangement:
Transcription unit        Promoter
ymdA
ymdAB
ymdAB-clsC
ymdB
ymdB-clsC
clsC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Douglass MV., Cleon F., Trent MS., 2021, Cardiolipin aids in lipopolysaccharide transport to the gram-negative outer membrane., Proc Natl Acad Sci U S A 118(15)

 [2] Qiu N., Misra R., 2019, Overcoming Iron Deficiency of an Escherichia coli tonB Mutant by Increasing Outer Membrane Permeability., J Bacteriol 201(17)

 [3] Rathmann C., Schlosser AS., Schiller J., Bogdanov M., Bruser T., 2017, Tat transport in Escherichia coli requires zwitterionic phosphatidylethanolamine but no specific negatively charged phospholipid., FEBS Lett 591(18):2848-2858


RegulonDB