RegulonDB RegulonDB 10.9: Gene Form
   

ariR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ymgA ariR ymgC

Gene      
Name: ariR    Texpresso search in the literature
Synonym(s): ECK1153, G6606, b1166, ymgB
Genome position(nucleotides): 1216369 --> 1216635 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
34.83


Product      
Name: putative two-component system connector protein AriR
Synonym(s): AriR, YmgB, regulator of acid resistance, influenced by indole
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.694
Isoelectric point: 4.368
Motif(s):
 
Type Positions Sequence
29 -> 87 EESAVLGQAVTNLMLSGDNVNNKNIILSLIHSLETTSDILKADVIRKTLEIVLRYTADD

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0042542 - response to hydrogen peroxide
GO:0044010 - single-species biofilm formation
GO:0071468 - cellular response to acidic pH
Note(s): Note(s): ...[more].
Reference(s): [1] Duval V., et al., 2017
[2] Kettles RA., et al., 2019
External database links:  
ECOCYC:
G6606-MONOMER
ECOLIWIKI:
b1166
INTERPRO:
IPR024753
PDB:
2OXL
PFAM:
PF10798
PRIDE:
P75993
PRODB:
PRO_000022137
REFSEQ:
NP_415684
SMR:
P75993
UNIPROT:
P75993


Operon      
Name: ycgZ-ymgA-ariR-ymgC         
Operon arrangement:
Transcription unit        Promoter
ycgZ-ymgA-ariR-ymgC
ycgZ-ymgA-ariR-ymgC
ariR
ycgZ
ymgA-ariR
ymgC


Transcriptional Regulation      
Display Regulation             
Activated by: MarA
Repressed by: BluR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Duval V., Foster K., Brewster J., Levy SB., 2017, A Novel Regulatory Cascade Involving BluR, YcgZ, and Lon Controls the Expression of Escherichia coli OmpF Porin., Front Microbiol 8:1148

 [2] Kettles RA., Tschowri N., Lyons KJ., Sharma P., Hengge R., Webber MA., Grainger DC., 2019, The Escherichia coli MarA protein regulates the ycgZ-ymgABC operon to inhibit biofilm formation., Mol Microbiol 112(5):1609-1625


RegulonDB