RegulonDB RegulonDB 11.0: Gene Form
   

rstA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rstB rstA ydgC folM PhoP tusp2 tusp2 rstAp rstAp TSS_1894 TSS_1894 ydgCp3 ydgCp3

Gene      
Name: rstA    Texpresso search in the literature
Synonym(s): ECK1603, G6864, b1608, urpT
Genome position(nucleotides): 1682159 --> 1682878
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.31
External database links:  
ASAP:
ABE-0005370
ECHOBASE:
EB2982
ECOLIHUB:
rstA
OU-MICROARRAY:
b1608
STRING:
511145.b1608
COLOMBOS: rstA


Product      
Name: DNA-binding transcriptional regulator RstA
Synonym(s): RstA, RstA response regulator, UrpT
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 26.704
Isoelectric point: 5.359
Motif(s):
 
Type Positions Sequence Comment
3 -> 116 TIVFVEDDAEVGSLIAAYLAKHDMQVTVEPRGDQAEETILRENPDLVLLDIMLPGKDGMTICRDLRAKWSGPIVLLTSLDSDMNHILALEMGACDYILKTTPPAVLLARLRLHL UniProt: Response regulatory.
4 -> 112 IVFVEDDAEVGSLIAAYLAKHDMQVTVEPRGDQAEETILRENPDLVLLDIMLPGKDGMTICRDLRAKWSGPIVLLTSLDSDMNHILALEMGACDYILKTTPPAVLLARL
136 -> 235 YKALHFGTLTIDPINRVVTLANTEISLSTADFELLWELATHAGQIMDRDALLKNLRGVSYDGLDRSVDVAISRLRKKLLDNAAEPYRIKTVRNKGYLFAP UniProt: OmpR/PhoB-type.
158 -> 233 TEISLSTADFELLWELATHAGQIMDRDALLKNLRGVSYDGLDRSVDVAISRLRKKLLDNAAEPYRIKTVRNKGYLF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0000156 - phosphorelay response regulator activity
GO:0000976 - transcription cis-regulatory region binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
External database links:  
ALPHAFOLD:
P52108
DIP:
DIP-10807N
ECOCYC:
RSTA-MONOMER
ECOLIWIKI:
b1608
INTERPRO:
IPR001789
INTERPRO:
IPR001867
INTERPRO:
IPR016032
INTERPRO:
IPR039420
INTERPRO:
IPR036388
INTERPRO:
IPR011006
MODBASE:
P52108
PANTHER:
PTHR48111
PFAM:
PF00072
PFAM:
PF00486
PRIDE:
P52108
PRODB:
PRO_000023889
PROSITE:
PS50110
PROSITE:
PS51755
REFSEQ:
NP_416125
SMART:
SM00448
SMART:
SM00862
SMR:
P52108
UNIPROT:
P52108


Operon      
Name: rstAB         
Operon arrangement:
Transcription unit        Promoter
rstAB


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydgCp3 1682062 reverse nd [ICWHO] [1]
  promoter TSS_1894 1682136 forward nd [RS-EPT-CBR] [2]
  promoter tusp2 1684173 forward nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB