RegulonDB RegulonDB 10.9: Gene Form
   

ydhF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhF sodC ydhL ydhFp3 ydhFp3 ydhFp1 ydhFp1 sodCp sodCp

Gene      
Name: ydhF    Texpresso search in the literature
Synonym(s): ECK1643, G6887, b1647
Genome position(nucleotides): 1724736 <-- 1725632 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.4
External database links:  
ASAP:
ABE-0005508
ECHOBASE:
EB3196
ECOLIHUB:
ydhF
OU-MICROARRAY:
b1647
STRING:
511145.b1647
COLOMBOS: ydhF


Product      
Name: putative oxidoreductase YdhF
Synonym(s): YdhF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.676
Isoelectric point: 6.122
Motif(s):
 
Type Positions Sequence
263 -> 264 SG
209 -> 220 WSCLGGGRLFND
18 -> 291 VMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALKLAPHLRERMEIVSKCGIATTAREENVIGHYITDRDHIIKSAEQSLINLATDHLDLLLIHRPDPLMDADEVADAFKHLHQSGKVRHFGVSNFTPAQFALLQSRLPFTLATNQVEISPVHQPLLLDGTLDQLQQLRVRPMAWSCLGGGRLFNDDYFQPLRDELAVVAEELNAGSIEQVVYAWVLRLPSQPLPIIGSGKIERVRAAVEAETLKMTRQQWFRIRKA
158 -> 159 SN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6887-MONOMER
ECOLIWIKI:
b1647
INTERPRO:
IPR036812
INTERPRO:
IPR020471
INTERPRO:
IPR023210
MODBASE:
P76187
PDB:
1UR3
PDB:
1OG6
PFAM:
PF00248
PRIDE:
P76187
PRINTS:
PR00069
REFSEQ:
YP_025305
SMR:
P76187
SWISSMODEL:
P76187
UNIPROT:
P76187


Operon      
Name: ydhF         
Operon arrangement:
Transcription unit        Promoter
ydhF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydhFp1 1725648 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydhFp3 1725655 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB