RegulonDB RegulonDB 10.9: Gene Form
   

gloA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nemA rnt gloA lhrp lhrp TSS_1931 TSS_1931 gloAp gloAp TSS_1930 TSS_1930 TSS_1929 TSS_1929

Gene      
Name: gloA    Texpresso search in the literature
Synonym(s): ECK1647, G6891, b1651
Genome position(nucleotides): 1727837 --> 1728244 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.47
External database links:  
ASAP:
ABE-0005520
ECHOBASE:
EB3197
ECOLIHUB:
gloA
OU-MICROARRAY:
b1651
STRING:
511145.b1651
COLOMBOS: gloA


Product      
Name: glyoxalase I
Synonym(s): GloA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.92
Isoelectric point: 4.673
Motif(s):
 
Type Positions Sequence
2 -> 126 RLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEE
3 -> 123 LLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIEL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.23 - methylglyoxal metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0004462 - lactoylglutathione lyase activity
GO:0016151 - nickel cation binding
GO:0042803 - protein homodimerization activity
biological_process GO:0019243 - methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione
GO:0009636 - response to toxic substance
Note(s): Note(s): ...[more].
Reference(s): [1] Reiger M., et al., 2015
External database links:  
DIP:
DIP-47995N
ECOCYC:
GLYOXI-MONOMER
ECOLIWIKI:
b1651
INTERPRO:
IPR037523
INTERPRO:
IPR029068
INTERPRO:
IPR018146
INTERPRO:
IPR004361
INTERPRO:
IPR004360
MODBASE:
P0AC81
PDB:
1FA8
PDB:
1F9Z
PDB:
1FA6
PDB:
1FA7
PDB:
1FA5
PFAM:
PF00903
PRIDE:
P0AC81
PROSITE:
PS51819
PROSITE:
PS00935
PROSITE:
PS00934
REFSEQ:
NP_416168
SMR:
P0AC81
UNIPROT:
P0AC81


Operon      
Name: nemRA-gloA         
Operon arrangement:
Transcription unit        Promoter
nemRA
nemRA-gloA
gloA
nemA
ydhM


Transcriptional Regulation      
Display Regulation             
Repressed by: NemR, RutR


Regulation by small RNA    
  Display Regulation
small RNA micA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1929 1727798 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1930 1727800 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1931 1727809 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Reiger M., Lassak J., Jung K., 2015, Deciphering the role of the type II glyoxalase isoenzyme YcbL (GlxII-2) in Escherichia coli., FEMS Microbiol Lett 362(2):1-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB