RegulonDB RegulonDB 10.9: Gene Form
   

ydiY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pfkB ydiY yniD anti-anti-terminator anti-terminator terminator terminator pfkBp1 pfkBp1 pfkBp2 pfkBp2 ydiYp11 ydiYp11 ydiYp6 ydiYp6 ydiYp12 ydiYp12

Gene      
Name: ydiY    Texpresso search in the literature
Synonym(s): ECK1720, G6928, b1722
Genome position(nucleotides): 1805325 <-- 1806083 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.41
External database links:  
ASAP:
ABE-0005744
ECHOBASE:
EB3740
ECOLIHUB:
ydiY
OU-MICROARRAY:
b1722
STRING:
511145.b1722
COLOMBOS: ydiY


Product      
Name: acid-inducible putative outer membrane protein YdiY
Synonym(s): YdiY
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 27.607
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
1 -> 23 MKLLKTVPAIVMLAGGMFASLNA
24 -> 252 AADDSVFTVMDDPASAKKPFEGNLNAGYLAQSGNTKSSSLTADTTMTWYGHTTAWSLWGNASNTSSNDERSSEKYAAGGRSRFNLTDYDYLFGQASWLTDRYNGYRERDVLTAGYGRQFLNGPVHSFRFEFGPGVRYDKYTDNASETQPLGYASGAYAWQLTDNAKFTQGVSVFGAEDTTLNSESALNVAINEHFGLKVAYNVTWNSEPPESAPEHTDRRTTLSLGYSM
48 -> 251 NAGYLAQSGNTKSSSLTADTTMTWYGHTTAWSLWGNASNTSSNDERSSEKYAAGGRSRFNLTDYDYLFGQASWLTDRYNGYRERDVLTAGYGRQFLNGPVHSFRFEFGPGVRYDKYTDNASETQPLGYASGAYAWQLTDNAKFTQGVSVFGAEDTTLNSESALNVAINEHFGLKVAYNVTWNSEPPESAPEHTDRRTTLSLGYS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Zhai Y., et al., 2002
External database links:  
ECOCYC:
G6928-MONOMER
ECOLIWIKI:
b1722
INTERPRO:
IPR007433
PFAM:
PF04338
PRIDE:
P76206
REFSEQ:
NP_416236
UNIPROT:
P76206


Operon      
Name: ydiY         
Operon arrangement:
Transcription unit        Promoter
ydiY


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydiYp12 1806170 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ydiYp6 1806217 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ydiYp11 1806250 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Zhai Y., Saier MH., 2002, The beta-barrel finder (BBF) program, allowing identification of outer membrane beta-barrel proteins encoded within prokaryotic genomes., Protein Sci 11(9):2196-207

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB