RegulonDB RegulonDB 10.9: Gene Form
   

yeaG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeaG yeaH mipA PhoB anti-terminator yeaGp1 yeaGp1 yeaGp2 yeaGp2 mipAp mipAp

Gene      
Name: yeaG    Texpresso search in the literature
Synonym(s): ECK1781, G6969, b1783
Genome position(nucleotides): 1866908 --> 1868842 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.13
External database links:  
ASAP:
ABE-0005935
ECHOBASE:
EB3266
ECOLIHUB:
yeaG
OU-MICROARRAY:
b1783
STRING:
511145.b1783
COLOMBOS: yeaG


Product      
Name: protein kinase YeaG
Synonym(s): YeaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 74.48
Isoelectric point: 5.626
Motif(s):
 
Type Positions Sequence
382 -> 636 YSKMRVYDGESLKDTDPKAKSYQEYRDYAGVDEGMNGLSTRFAFKILSRVFNFDHVEVAANPVHLFYVLEQQIEREQFPQEQAERYLEFLKGYLIPKYAEFIGKEIQTAYLESYSEYGQNIFDRYVTYADFWIQDQEYRDPDTGQLFDRESLNAELEKIEKPAGISNPKDFRNEIVNFVLRARANNSGRNPNWTSYEKLRTVIEKKMFSNTEELLPVISFNAKTSTDEQKKHDDFVDRMMEKGYTRKQVRLLCEW
20 -> 380 TLQEFLTTCRQDRSAYANAAERLLMAIGEPVMVDTAQEPRLSRLFSNRVIARYPAFEEFYGMEDAIEQIVSYLKHAAQGLEEKKQILYLLGPVGGGKSSLAERLKSLMQLVPIYVLSANGERSPVNDHPFCLFNPQEDAQILEKEYGIPRRYLGTIMSPWAAKRLHEFGGDITKFRVVKVWPSILQQIAIAKTEPGDENNQDISALVGKVDIRKLEHYAQNDPDAYGYSGALCRANQGIMEFVEMFKAPIKVLHPLLTATQEGNYNGTEGISALPFNGIILAHSNESEWVTFRNNKNNEAFLDRVYIVKVPYCLRISEEIKIYEKLLNHSELTHAPCAPGTLETLSRFSILSRLKEPENSS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004672 - protein kinase activity
biological_process GO:0006468 - protein phosphorylation
GO:0006995 - cellular response to nitrogen starvation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Andres Leon E., et al., 2009
[2] Figueira R., et al., 2015
External database links:  
DIP:
DIP-35826N
ECOCYC:
G6969-MONOMER
ECOLIWIKI:
b1783
INTERPRO:
IPR016230
INTERPRO:
IPR013153
INTERPRO:
IPR010650
INTERPRO:
IPR027417
PFAM:
PF08298
PFAM:
PF06798
PRIDE:
P0ACY3
REFSEQ:
NP_416297
SMART:
SM00763
UNIPROT:
P0ACY3


Operon      
Name: yeaGH         
Operon arrangement:
Transcription unit        Promoter
yeaGH
yeaGH


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Andres Leon E., Ezkurdia I., Garcia B., Valencia A., Juan D., 2009, EcID. A database for the inference of functional interactions in E. coli., Nucleic Acids Res 37(Database issue):D629-35

 [2] Figueira R., Brown DR., Ferreira D., Eldridge MJ., Burchell L., Pan Z., Helaine S., Wigneshweraraj S., 2015, Adaptation to sustained nitrogen starvation by Escherichia coli requires the eukaryote-like serine/threonine kinase YeaG., Sci Rep 5:17524


RegulonDB