RegulonDB RegulonDB 10.9: Gene Form
   

yoaF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcP yeaO yoaF TSS_2126 TSS_2126 TSS_2125 TSS_2125 yoaFp10 yoaFp10 yeaPp3 yeaPp3 yeaPp yeaPp

Gene      
Name: yoaF    Texpresso search in the literature
Synonym(s): ECK1791, G6979, b1793
Genome position(nucleotides): 1877278 <-- 1877532 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.55
External database links:  
ASAP:
ABE-0005966
ECHOBASE:
EB4051
ECOLIHUB:
yoaF
OU-MICROARRAY:
b1793
STRING:
511145.b1793
COLOMBOS: yoaF


Product      
Name: DUF333 domain-containing lipoprotein YoaF
Synonym(s): YoaF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.942
Isoelectric point: 7.936
Motif(s):
 
Type Positions Sequence
32 -> 78 GMANPASVYCQQKGGTLIPVQTAQGVSNNCKLPGGETIDEWALWRRD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6979-MONOMER
ECOLIWIKI:
b1793
INTERPRO:
IPR005590
PFAM:
PF03891
PRIDE:
P64493
REFSEQ:
NP_416307
UNIPROT:
P64493


Operon      
Name: yoaF         
Operon arrangement:
Transcription unit        Promoter
yoaF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeaPp3 1877666 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yoaFp10 1877722 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2125 1878552 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2126 1878589 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB