RegulonDB RegulonDB 10.9: Gene Form
   

yedL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yedN yedK yedL fliE intG anti-anti-terminator anti-terminator terminator

Gene      
Name: yedL    Texpresso search in the literature
Synonym(s): ECK1931, G7040, b1932
Genome position(nucleotides): 2010600 --> 2011079 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.08
External database links:  
ASAP:
ABE-0006433
ECHOBASE:
EB3064
ECOLIHUB:
yedL
OU-MICROARRAY:
b1932
STRING:
511145.b1932
COLOMBOS: yedL


Product      
Name: putative acetyltransferase YedL
Synonym(s): YedL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.891
Isoelectric point: 7.0
Motif(s):
 
Type Positions Sequence
30 -> 130 PPESSHALDVQKLRNPTVTFWSVWEGEQLAGIGALKLLDDKHGELKSMRTAPNYLRRGVASLILRHILQVAQDRCLHRLSLETGTQAGFTACHQLYLKHGF
4 -> 153 IKTDDLTHPAVQALVAYHISGMLQQSPPESSHALDVQKLRNPTVTFWSVWEGEQLAGIGALKLLDDKHGELKSMRTAPNYLRRGVASLILRHILQVAQDRCLHRLSLETGTQAGFTACHQLYLKHGFADCEPFADYRLDPHSRFLSLTLC

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7040-MONOMER
ECOLIWIKI:
b1932
INTERPRO:
IPR016181
INTERPRO:
IPR000182
MODBASE:
P76319
PFAM:
PF00583
PRIDE:
P76319
PROSITE:
PS51186
REFSEQ:
NP_416442
SWISSMODEL:
P76319
UNIPROT:
P76319


Operon      
Name: yedL         
Operon arrangement:
Transcription unit        Promoter
yedL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB