RegulonDB RegulonDB 10.9: Gene Form
   

yegL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pphC yegL yegJ sibA ibsA SibA sibAp sibAp

Gene      
Name: yegL    Texpresso search in the literature
Synonym(s): ECK2067, G7112, b2073
Genome position(nucleotides): 2152469 <-- 2153128 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.06
External database links:  
ASAP:
ABE-0006867
ECHOBASE:
EB3808
ECOLIHUB:
yegL
OU-MICROARRAY:
b2073
STRING:
511145.b2073
COLOMBOS: yegL


Product      
Name: IPR002035 domain-containing protein YegL
Synonym(s): YegL
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 24.218
Isoelectric point: 4.902
Motif(s):
 
Type Positions Sequence
24 -> 173 LLLDVSGSMNGRPINELNAGLVTFRDELLADPLALKRVELGIVTFGPVHVEQPFTSAANFFPPILFAQGDTPMGAAITKALDMVEERKREYRANGISYYRPWIFLITDGAPTDEWQAAANKVFRGEEDKRFAFFSIGVQGADMKTLAQIS
21 -> 199 PCILLLDVSGSMNGRPINELNAGLVTFRDELLADPLALKRVELGIVTFGPVHVEQPFTSAANFFPPILFAQGDTPMGAAITKALDMVEERKREYRANGISYYRPWIFLITDGAPTDEWQAAANKVFRGEEDKRFAFFSIGVQGADMKTLAQISVRQPLPLQGLQFRELFSWLSSSLRSV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11882N
ECOCYC:
G7112-MONOMER
ECOLIWIKI:
b2073
INTERPRO:
IPR011392
INTERPRO:
IPR002035
INTERPRO:
IPR036465
MODBASE:
P76396
PFAM:
PF00092
PRIDE:
P76396
PROSITE:
PS50234
REFSEQ:
NP_416577
SMART:
SM00327
UNIPROT:
P76396


Operon      
Name: yegL-pphC         
Operon arrangement:
Transcription unit        Promoter
yegL-pphC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB