RegulonDB RegulonDB 10.9: Gene Form
   

maeB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maeB talA eutS CreB anti-anti-terminator anti-terminator terminator tktBp tktBp TSS_2750 TSS_2750 talAp talAp talAp1 talAp1 talAp2 talAp2 TSS_2749 TSS_2749

Gene      
Name: maeB    Texpresso search in the literature
Synonym(s): ECK2458, G7293, b2463, ypfF
Genome position(nucleotides): 2576098 <-- 2578377 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.12
External database links:  
ASAP:
ABE-0008111
ECHOBASE:
EB3945
ECOLIHUB:
maeB
OU-MICROARRAY:
b2463
STRING:
511145.b2463
COLOMBOS: maeB


Product      
Name: NADP+-dependent malate dehydrogenase
Synonym(s): MaeB, YpfF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 82.417
Isoelectric point: 5.156
Motif(s):
 
Type Positions Sequence
430 -> 751 FMKPIFSQARKAPKRVVLPEGEEARVLHATQELVTLGLAKPILIGRPNVIEMRIQKLGLQIKAGVDFEIVNNESDPRFKEYWTEYFQIMKRRGVTQEQAQRALISNPTVIGAIMVQRGEADAMICGTVGDYHEHFSVVKNVFGYRDGVHTAGAMNALLLPSGNTFIADTYVNDEPDAEELAEITLMAAETVRRFGIEPRVALLSHSNFGSSDCPSSSKMRQALELVRERAPELMIDGEMHGDAALVEAIRNDRMPDSSLKGSANILVMPNMEAARISYNLLRVSSSEGVTVGPVLMGVAKPVHVLTPIASVRRIVNMVALAV
19 -> 151 GKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLKAYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDELDPDKFIEVVAALEPTFGGINLEDIKAPECFYIEQKLR
76 -> 83 VLGLGNIG
165 -> 360 GTAIISTAAILNGLRVVEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCDSKGVIYQGREPNMAETKAAYAVVDDGKRTLDDVIEGADIFLGCSGPKVLTQEMVKKMARAPMILALANPEPEILPPLAKEVRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVRAIAELAHAEQS
1 -> 428 MDDQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLKAYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDELDPDKFIEVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISTAAILNGLRVVEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCDSKGVIYQGREPNMAETKAAYAVVDDGKRTLDDVIEGADIFLGCSGPKVLTQEMVKKMARAPMILALANPEPEILPPLAKEVRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVRAIAELAHAEQSEVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKAAMESGVATRPIADFDVYIDKLTEFVYKTN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0004470 - malic enzyme activity
GO:0004473 - malate dehydrogenase (decarboxylating) (NADP+) activity
GO:0008948 - oxaloacetate decarboxylase activity
GO:0030145 - manganese ion binding
GO:0051287 - NAD binding
GO:0004471 - malate dehydrogenase (decarboxylating) (NAD+) activity
biological_process GO:0008152 - metabolic process
GO:0006108 - malate metabolic process
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-10141N
ECOCYC:
MALIC-NADP-MONOMER
ECOLIWIKI:
b2463
INTERPRO:
IPR036291
INTERPRO:
IPR042113
INTERPRO:
IPR042112
INTERPRO:
IPR037062
INTERPRO:
IPR015884
INTERPRO:
IPR012302
INTERPRO:
IPR012301
INTERPRO:
IPR012188
INTERPRO:
IPR002505
MODBASE:
P76558
PFAM:
PF01515
PFAM:
PF00390
PFAM:
PF03949
PRIDE:
P76558
PRODB:
PRO_000025146
PROSITE:
PS00331
REFSEQ:
NP_416958
SMART:
SM01274
SMART:
SM00919
SMR:
P76558
UNIPROT:
P76558


Operon      
Name: maeB         
Operon arrangement:
Transcription unit        Promoter
maeB


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2749 2578531 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2750 2578793 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB