RegulonDB RegulonDB 11.1: Gene Form
   

amiC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

argA amiC metV ArgR ArgR amiCp6 amiCp6 argAp argAp amiCp7 amiCp7 TSS_3126 TSS_3126 TSS_3125 TSS_3125

Gene      
Name: amiC    Texpresso search in the literature
Synonym(s): ECK2813, G7458, b2817, ygdN
Genome position(nucleotides): 2947757 <-- 2949010
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.51
External database links:  
ASAP:
ABE-0009238
ECHOBASE:
EB2895
ECOLIHUB:
amiC
OU-MICROARRAY:
b2817
STRING:
511145.b2817
COLOMBOS: amiC


Product      
Name: N-acetylmuramoyl-L-alanine amidase C
Synonym(s): AmiC, YgdN
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 45.634
Isoelectric point: 10.189
Motif(s):
 
Type Positions Sequence Comment
1 -> 31 MSGSNTAISRRRLLQGAGAMWLLSVSQVSLA UniProt: Tat-type signal.
30 -> 145 LAAVSQVVAVRVWPASSYTRVTVESNRQLKYKQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVGQFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDLYPA peptidoglycan binding domain
32 -> 417 AVSQVVAVRVWPASSYTRVTVESNRQLKYKQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVGQFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDLYPANAQDMQDPLLALLEDYNKGDLEKQVPPAQSGPQPGKAGRDRPIVIMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRSLIEKEGNMKVYMTRNEDIFIPLQVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFALSTKGATSTAAKYLAQTQNASDLIGGVSKSGDRYVDHTMFDMVQSLTIADSLKFGKAVLNKLGKINKLHKNQVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAESILAGIKAYFADGATLARRG UniProt: N-acetylmuramoyl-L-alanine amidase AmiC.
36 -> 42 VVAVRVW
39 -> 142 VRVWPASSYTRVTVESNRQLKYKQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVGQFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  5 - cell processes --> 5.1 - cell division
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0008745 - N-acetylmuramoyl-L-alanine amidase activity
biological_process GO:0051301 - cell division
GO:0043093 - FtsZ-dependent cytokinesis
GO:0009253 - peptidoglycan catabolic process
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Parquet C., et al., 1983
[2] van Heijenoort J., et al., 1975
External database links:  
ALPHAFOLD:
P63883
ECOCYC:
G7458-MONOMER
ECOLIWIKI:
b2817
INTERPRO:
IPR006311
INTERPRO:
IPR021731
INTERPRO:
IPR002508
MODBASE:
P63883
PDB:
4BIN
PFAM:
PF01520
PFAM:
PF11741
PRIDE:
P63883
PROSITE:
PS51318
REFSEQ:
NP_417294
SMART:
SM00646
SMR:
P63883
SWISSMODEL:
P63883
UNIPROT:
P63883


Operon      
Name: amiC         
Operon arrangement:
Transcription unit        Promoter
amiC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3125 2947607 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3126 2949064 reverse nd [RS-EPT-CBR] [3]
  promoter amiCp7 2949066 reverse nd [COMP-AINF] [4]
  promoter amiCp6 2949189 reverse nd [COMP-AINF] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [COMP-AINF] Inferred computationally without human oversight



Reference(s)    

 [1] Parquet C., Flouret B., Leduc M., Hirota Y., van Heijenoort J., 1983, N-acetylmuramoyl-L-alanine amidase of Escherichia coli K12. Possible physiological functions., Eur J Biochem 133(2):371-7

 [2] van Heijenoort J., Parquet C., Flouret B., van Heijenoort Y., 1975, Envelope-bound N-acetylmuramyl-L-alanine amidase of Escherichia coli K 12. Purification and properties of the enzyme., Eur J Biochem 58(2):611-9

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB