RegulonDB RegulonDB 10.9: Gene Form
   

cpdA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

parE cpdA yqiA yqiB TSS_3332 TSS_3332 TSS_3331 TSS_3331 TSS_3330 TSS_3330 TSS_3329 TSS_3329

Gene      
Name: cpdA    Texpresso search in the literature
Synonym(s): ECK3023, G7579, b3032, icc
Genome position(nucleotides): 3176006 <-- 3176833 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.52
Reference(s): [1] Imamura R., et al., 1996
External database links:  
ASAP:
ABE-0009957
ECHOBASE:
EB2104
ECOLIHUB:
cpdA
OU-MICROARRAY:
b3032
STRING:
511145.b3032
COLOMBOS: cpdA


Product      
Name: cAMP phosphodiesterase
Synonym(s): CpdA, Icc
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.938
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
94 -> 95 NH
16 -> 206 RILQITDTHLFAQKHEALLGVNTWESYQAVLEAIRPHQHEFDLIVATGDLAQDQSSAAYQHFAEGIASFRAPCVWLPGNHDFQPAMYSALQDAGISPAKRVFIGEQWQILLLDSQVFGVPHGELSEFQLEWLERKLADAPERHTLLLLHHHPLPAGCSWLDQHSLRNAGELDTVLAKFPHVKYLLCGHIHQ

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.4 - proteases, cleavage of compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0008198 - ferrous iron binding
GO:0004115 - 3',5'-cyclic-AMP phosphodiesterase activity
biological_process GO:0042545 - cell wall modification
Note(s): Note(s): ...[more].
Reference(s): [2] Chu W., et al., 2012
[3] Li G., et al., 2014
External database links:  
ECOCYC:
G7579-MONOMER
ECOLIWIKI:
b3032
INTERPRO:
IPR026575
INTERPRO:
IPR029052
INTERPRO:
IPR004843
MODBASE:
P0AEW4
PFAM:
PF00149
PRIDE:
P0AEW4
PRODB:
PRO_000022988
REFSEQ:
NP_417504
UNIPROT:
P0AEW4


Operon      
Name: nudF-yqiB-cpdA-yqiA-parE         
Operon arrangement:
Transcription unit        Promoter
nudF-yqiB-cpdA-yqiA-parE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3329 3174907 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3330 3175645 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3331 3176921 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3332 3176965 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Imamura R., Yamanaka K., Ogura T., Hiraga S., Fujita N., Ishihama A., Niki H., 1996, Identification of the cpdA gene encoding cyclic 3',5'-adenosine monophosphate phosphodiesterase in Escherichia coli., J Biol Chem 271(41):25423-9

 [2] Chu W., Zere TR., Weber MM., Wood TK., Whiteley M., Hidalgo-Romano B., Valenzuela E., McLean RJ., 2012, Indole production promotes Escherichia coli mixed-culture growth with Pseudomonas aeruginosa by inhibiting quorum signaling., Appl Environ Microbiol 78(2):411-9

 [3] Li G., Young KD., 2014, A cAMP-independent carbohydrate-driven mechanism inhibits tnaA expression and TnaA enzyme activity in Escherichia coli., Microbiology 160(Pt 9):2079-88

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB