RegulonDB RegulonDB 10.9: Gene Form
   

kdsC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kdsD lptC kdsC lptA TSS_3513 TSS_3513 lptBp lptBp lptAp1 lptAp1 TSS_3512 TSS_3512 TSS_3511 TSS_3511 lptAp2 lptAp2 TSS_3510 TSS_3510 TSS_3509 TSS_3509 kdsCp1 kdsCp1 TSS_3508 TSS_3508 kdsCp2 kdsCp2 kdsCp3 kdsCp3 TSS_3506 TSS_3506

Gene      
Name: kdsC    Texpresso search in the literature
Synonym(s): ECK3187, G7663, b3198, yrbI, yrbJ
Genome position(nucleotides): 3342273 --> 3342839 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.56
External database links:  
ASAP:
ABE-0010506
ECHOBASE:
EB2656
ECOLIHUB:
kdsC
OU-MICROARRAY:
b3198
STRING:
511145.b3198
COLOMBOS: kdsC


Product      
Name: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC
Synonym(s): KdsC, YrbI, YrbJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.997
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
55 -> 59 NVRDG
94 -> 158 HLYQGQSNKLIAFSDLLEKLAIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTR
2 -> 188 SKAGASLATCYGPVSADVIAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGYGIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKLDEAKGQSI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016788 - hydrolase activity, acting on ester bonds
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0019143 - 3-deoxy-manno-octulosonate-8-phosphatase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Wen L., et al., 2016
[2] Yi L., et al., 2011
External database links:  
DIP:
DIP-48034N
ECOCYC:
G7663-MONOMER
ECOLIWIKI:
b3198
INTERPRO:
IPR010023
INTERPRO:
IPR036412
INTERPRO:
IPR023214
MODBASE:
P0ABZ4
PFAM:
PF08282
PRIDE:
P0ABZ4
PRODB:
PRO_000023056
REFSEQ:
NP_417665
SMR:
P0ABZ4
SWISSMODEL:
P0ABZ4
UNIPROT:
P0ABZ4


Operon      
Name: yrbG-kdsDC-lptCAB-rpoN-hpf-ptsN-rapZ-npr         
Operon arrangement:
Transcription unit        Promoter
yrbG-kdsD
yrbG-kdsDC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
lptAB
lptAB
lptB-rpoN-hpf-ptsN-yhbJ
rpoN-hpf-ptsN-yhbJ-npr


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3506 3341718 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3508 3342094 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3509 3343164 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3510 3343168 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3511 3343300 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3512 3343302 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3513 3343446 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Wen L., Zheng Y., Li T., Wang PG., 2016, Enzymatic synthesis of 3-deoxy-d-manno-octulosonic acid (KDO) and its application for LPS assembly., Bioorg Med Chem Lett 26(12):2825-2828

 [2] Yi L., Velasquez MS., Holler TP., Woodard RW., 2011, A simple assay for 3-deoxy-d-manno-octulosonate cytidylyltransferase and its use as a pathway screen., Anal Biochem 416(2):152-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB