RegulonDB RegulonDB 10.9: Gene Form
   

lptC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kdsD lptB lptC kdsC lptA rpoNp rpoNp TSS_3513 TSS_3513 lptBp lptBp lptAp1 lptAp1 TSS_3512 TSS_3512 TSS_3511 TSS_3511 lptAp2 lptAp2 TSS_3510 TSS_3510 TSS_3509 TSS_3509 kdsCp1 kdsCp1 TSS_3508 TSS_3508 kdsCp2 kdsCp2 kdsCp3 kdsCp3 TSS_3506 TSS_3506

Gene      
Name: lptC    Texpresso search in the literature
Synonym(s): ECK3188, G7664, b3199, yrbK
Genome position(nucleotides): 3342836 --> 3343411 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.35
External database links:  
ASAP:
ABE-0010508
ECHOBASE:
EB2657
ECOLIHUB:
lptC
OU-MICROARRAY:
b3199
STRING:
511145.b3199
COLOMBOS: lptC


Product      
Name: lipopolysaccharide transport system protein LptC
Synonym(s): LptC, YrbK
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 21.703
Isoelectric point: 6.81
Motif(s):
 
Type Positions Sequence
12 -> 183 LSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYE
56 -> 56 G
177 -> 191 KVRTSYEIQNKQTQP
2 -> 2 S
7 -> 24 WVIIVLSLAVLVMIGINM

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:1990351 - transporter complex
molecular_function GO:0005515 - protein binding
GO:0015221 - lipopolysaccharide transmembrane transporter activity
GO:0017089 - glycolipid transfer activity
GO:0042802 - identical protein binding
biological_process GO:0015920 - lipopolysaccharide transport
GO:0043165 - Gram-negative-bacterium-type cell outer membrane assembly
GO:0046836 - glycolipid transport
Note(s): Note(s): ...[more].
Reference(s): [1] Benedet M., et al., 2016
[2] Kostner M., et al., 2006
[3] Martorana AM., et al., 2016
[4] More N., et al., 2019
External database links:  
DIP:
DIP-12912N
DISPROT:
DP02197
ECOCYC:
G7664-MONOMER
ECOLIWIKI:
b3199
INTERPRO:
IPR010664
INTERPRO:
IPR026265
MINT:
P0ADV9
PDB:
3MY2
PDB:
4B54
PDB:
6MI7
PFAM:
PF06835
PRIDE:
P0ADV9
PRODB:
PRO_000023115
REFSEQ:
NP_417666
SMR:
P0ADV9
UNIPROT:
P0ADV9


Operon      
Name: yrbG-kdsDC-lptCAB-rpoN-hpf-ptsN-rapZ-npr         
Operon arrangement:
Transcription unit        Promoter
yrbG-kdsD
yrbG-kdsDC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
lptAB
lptAB
lptB-rpoN-hpf-ptsN-yhbJ
rpoN-hpf-ptsN-yhbJ-npr


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3506 3341718 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3508 3342094 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3509 3343164 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3510 3343168 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3511 3343300 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3512 3343302 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3513 3343446 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Benedet M., Falchi FA., Puccio S., Di Benedetto C., Peano C., Polissi A., Deho G., 2016, The Lack of the Essential LptC Protein in the Trans-Envelope Lipopolysaccharide Transport Machine Is Circumvented by Suppressor Mutations in LptF, an Inner Membrane Component of the Escherichia coli Transporter., PLoS One 11(8):e0161354

 [2] Kostner M., Schmidt B., Bertram R., Hillen W., 2006, Generating tetracycline-inducible auxotrophy in Escherichia coli and Salmonella enterica serovar Typhimurium by using an insertion element and a hyperactive transposase., Appl Environ Microbiol 72(7):4717-25

 [3] Martorana AM., Benedet M., Maccagni EA., Sperandeo P., Villa R., Deho G., Polissi A., 2016, Functional Interaction between the Cytoplasmic ABC Protein LptB and the Inner Membrane LptC Protein, Components of the Lipopolysaccharide Transport Machinery in Escherichia coli., J Bacteriol 198(16):2192-203

 [4] More N., Martorana AM., Biboy J., Otten C., Winkle M., Serrano CKG., Monton Silva A., Atkinson L., Yau H., Breukink E., den Blaauwen T., Vollmer W., Polissi A., 2019, Peptidoglycan Remodeling Enables Escherichia coli To Survive Severe Outer Membrane Assembly Defect., MBio 10(1)

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB