RegulonDB RegulonDB 11.0: Gene Form

rzoR gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

trkG ydaW rzpR rzoR b1364 ynaKp10 ynaKp10 trkGp8 trkGp8 trkGp1 trkGp1 trkGp7 trkGp7

Name: rzoR    Texpresso search in the literature
Synonym(s): ECK1361, G0-10449, b4528
Genome position(nucleotides): 1423400 --> 1423585
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: Rac prophage; putative prophage outer membrane lipoprotein RzoR
Synonym(s): RzoR
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 6.761
Isoelectric point: 8.975
Type Positions Sequence Comment
20 -> 61 CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW UniProt: Prophage outer membrane lipoprotein RzoR.


Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
biological_process GO:0019076 - viral release from host cell
GO:0019835 - cytolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Rao S., et al., 2020
External database links:  

Name: rzoR         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter trkGp7 1423671 forward nd [ICWHO] [2]
  promoter trkGp1 1423741 forward nd [ICWHO] [2]
  promoter trkGp8 1423749 forward nd [ICWHO] [2]
  promoter ynaKp10 1425219 forward nd [ICWHO] [2]


 [ICWHO] Inferred computationally without human oversight


 [1] Rao S., Bates GT., Matthews CR., Newport TD., Vickery ON., Stansfeld PJ., 2020, Characterizing Membrane Association and Periplasmic Transfer of Bacterial Lipoproteins through Molecular Dynamics Simulations., Structure 28(4):475-487.e3

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78
