RegulonDB RegulonDB 11.0: Gene Form

yifL gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

dapF yzcX cyaY yifL yigA yifLp yifLp TSS_4467 TSS_4467 cyaYp5 cyaYp5

Name: yifL    Texpresso search in the literature
Synonym(s): ECK3803, G0-10471, b4558
Genome position(nucleotides): 3994522 --> 3994725
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: putative lipoprotein YifL
Synonym(s): YifL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.177
Isoelectric point: 9.194
Type Positions Sequence Comment
26 -> 67 LYFPPADKNAPPPTKPVETQTQSTVPDKNDRATGDGPSQVNY UniProt: Disordered; Sequence Annotation Type: region of interest.
39 -> 67 TKPVETQTQSTVPDKNDRATGDGPSQVNY UniProt: Polar residues; Sequence Annotation Type: compositionally biased region.


Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Rao S., et al., 2020
External database links:  

Name: yifL-dapF-yigA-xerC-yigB         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cyaYp5 3994083 reverse nd [ICWHO], [RS-EPT-CBR] [3], [4]
  promoter TSS_4467 3994491 forward nd [RS-EPT-CBR] [4]


 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Rao S., Bates GT., Matthews CR., Newport TD., Vickery ON., Stansfeld PJ., 2020, Characterizing Membrane Association and Periplasmic Transfer of Bacterial Lipoproteins through Molecular Dynamics Simulations., Structure 28(4):475-487.e3

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
