RegulonDB RegulonDB 10.8: Gene Form
   

cydC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cydD cydC aat TSS_1058 TSS_1058 cydCp5 cydCp5 TSS_1057 TSS_1057 aatp5 aatp5

Gene      
Name: cydC    Texpresso search in the literature
Synonym(s): ECK0877, EG10012, b0886, mdrA, mdrH, surB, ycaB
Genome position(nucleotides): 927474 <-- 929195 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.77
External database links:  
ASAP:
ABE-0003012
CGSC:
17725
ECHOBASE:
EB0012
OU-MICROARRAY:
b0886
PortEco:
cydC
STRING:
511145.b0886
COLOMBOS: cydC


Product      
Name: glutathione/L-cysteine ABC exporter subunit CydC
Synonym(s): CydC, MdrA, MdrH, SurB, YcaB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 62.92
Isoelectric point: 8.902
Motif(s):
 
Type Positions Sequence
58 -> 287 NYMLPAAGVRGAAITRTAGRYFERLVSHDATFRVLQHLRIYTFSKLLPLSPAGLARYRQGELLNRVVADVDTLDHLYLRVISPLVGAFVVIMVVTIGLSFLDFTLAFTLGGIMLLTLFLMPPLFYRAGKSTGQNLTHLRGQYRQQLTAWLQGQAELTIFGASDRYRTQLENTEIQWLEAQRRQSELTALSQAIMLLIGALAVILMLWMASGGVGGNAQPGALIALFVFCA
68 -> 136 GAAITRTAGRYFERLVSHDATFRVLQHLRIYTFSKLLPLSPAGLARYRQGELLNRVVADVDTLDHLYLR
282 -> 302 LFVFCALAAFEALAPVTGAFQ
480 -> 481 LR
47 -> 67 AVAGVAGLYSFNYMLPAAGVR

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.am - ABC superfamily, ATP binding and membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0045454 - cell redox homeostasis
GO:0055085 - transmembrane transport
GO:0033228 - cysteine export across plasma membrane
GO:0034775 - glutathione transmembrane transport
GO:0070453 - regulation of heme biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Xu Y., et al., 2017
External database links:  
DIP:
DIP-9362N
ECOCYC:
CYDC-MONOMER
ECOLIWIKI:
b0886
INTERPRO:
IPR014223
INTERPRO:
IPR036640
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR011527
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P23886
PFAM:
PF00005
PFAM:
PF00664
PRIDE:
P23886
PRODB:
PRO_000022363
PROSITE:
PS00211
PROSITE:
PS50929
PROSITE:
PS50893
REFSEQ:
NP_415406
SMART:
SM00382
SMR:
P23886
UNIPROT:
P23886


Operon      
Name: cydDC         
Operon arrangement:
Transcription unit        Promoter
cydDC


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ArcA, NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter aatp5 927460 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1057 928505 reverse nd [RS-EPT-CBR] [3]
  promoter cydCp5 929400 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1058 929741 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Xu Y., Liu Y., Li F., Cao G., Zheng P., Sun J., Wen J., Zhang D., 2017, Identification of a new gene yecC involved in threonine export in Escherichia coli., FEMS Microbiol Lett 364(17)

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB