RegulonDB RegulonDB 10.9: Gene Form
   

mepM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mepM lpxM znuA anti-anti-terminator anti-terminator terminator yebAp5 yebAp5 yebAp6 yebAp6 yebAp1 yebAp1 TSS_2210 TSS_2210 TSS_2209 TSS_2209 lpxMp4 lpxMp4

Gene      
Name: mepM    Texpresso search in the literature
Synonym(s): ECK1857, EG10013, b1856, yebA
Genome position(nucleotides): 1940313 <-- 1941635 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.46
External database links:  
ASAP:
ABE-0006189
ECHOBASE:
EB0013
ECOLIHUB:
yebA
OU-MICROARRAY:
b1856
STRING:
511145.b1856
COLOMBOS: mepM


Product      
Name: peptidoglycan DD-endopeptidase MepM
Synonym(s): MepM, YebA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 49.058
Isoelectric point: 10.014
Motif(s):
 
Type Positions Sequence
96 -> 141 HEYVVSTGDTLSSILNQYGIDMGDITQLAAADKELRNLKIGQQLSW
12 -> 39 FNNLPRPHRVMLGSLTVLTLAVAVWRPY
90 -> 90 A
98 -> 141 YVVSTGDTLSSILNQYGIDMGDITQLAAADKELRNLKIGQQLSW
21 -> 40 VMLGSLTVLTLAVAVWRPYV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004175 - endopeptidase activity
GO:0004222 - metalloendopeptidase activity
GO:0008237 - metallopeptidase activity
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0000910 - cytokinesis
GO:0006508 - proteolysis
GO:0009254 - peptidoglycan turnover
GO:0045227 - capsule polysaccharide biosynthetic process
GO:0000920 - septum digestion after cytokinesis
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Shin JH., et al., 2020
External database links:  
ECOCYC:
EG10013-MONOMER
ECOLIWIKI:
b1856
INTERPRO:
IPR016047
INTERPRO:
IPR018392
INTERPRO:
IPR013731
INTERPRO:
IPR011055
MODBASE:
P0AFS9
PFAM:
PF01551
PFAM:
PF01476
PFAM:
PF08525
PRIDE:
P0AFS9
PROSITE:
PS51782
REFSEQ:
NP_416370
SMART:
SM00257
SMR:
P0AFS9
SWISSMODEL:
P0AFS9
UNIPROT:
P0AFS9


Operon      
Name: mepM         
Operon arrangement:
Transcription unit        Promoter
yebA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter lpxMp4 1940228 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2209 1940588 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2210 1940853 reverse nd [RS-EPT-CBR] [3]
  promoter yebAp1 1941683 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yebAp6 1941721 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yebAp5 1941833 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Shin JH., Sulpizio AG., Kelley A., Alvarez L., Murphy SG., Fan L., Cava F., Mao Y., Saper MA., Dorr T., 2020, Structural basis of peptidoglycan endopeptidase regulation., Proc Natl Acad Sci U S A 117(21):11692-11702

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB