RegulonDB RegulonDB 11.0: Gene Form
   

yjiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjiA mrr yjiX yjiAp7 yjiAp7 yjiAp6 yjiAp6

Gene      
Name: yjiA    Texpresso search in the literature
Synonym(s): ECK4342, EG10021, b4352
Genome position(nucleotides): 4587909 <-- 4588865
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.65
External database links:  
ASAP:
ABE-0014273
ECHOBASE:
EB0020
ECOLIHUB:
yjiA
OU-MICROARRAY:
b4352
STRING:
511145.b4352
COLOMBOS: yjiA


Product      
Name: P-loop guanosine triphosphatase YjiA
Synonym(s): YjiA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.66
Isoelectric point: 4.533
Motif(s):
 
Type Positions Sequence Comment
6 -> 183 VTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSVDDQLIGDRATQIKTLTNGCICCSRSNELEDALLDLLDNLDKGNIQFDRLVIECTGMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVGYADRILLTKTDVAGEAEKLHERLARINARAPVY
11 -> 19 GFLGAGKTT UniProt: GTP.
224 -> 315 ISSIVVELDYPVDISEVSRVMENLLLESADKLLRYKGMLWIDGEPNRLLFQGVQRLYSADWDRPWGDEKPHSTMVFIGIQLPEEEIRAAFAG UniProt: CobW C-terminal.

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046914 - transition metal ion binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0005525 - GTP binding
GO:0042802 - identical protein binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
Reference(s): [1] Edmonds KA., et al., 2021
[2] Haas CE., et al., 2009
External database links:  
ALPHAFOLD:
P24203
DIP:
DIP-12630N
ECOCYC:
EG10021-MONOMER
ECOLIWIKI:
b4352
INTERPRO:
IPR027417
INTERPRO:
IPR036627
INTERPRO:
IPR011629
INTERPRO:
IPR003495
MODBASE:
P24203
PDB:
4IXM
PDB:
4IXN
PDB:
1NIJ
PFAM:
PF02492
PFAM:
PF07683
PRIDE:
P24203
REFSEQ:
NP_418772
SMART:
SM00833
SMR:
P24203
UNIPROT:
P24203


Operon      
Name: yjiXA         
Operon arrangement:
Transcription unit        Promoter
yjiXA


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjiAp6 4588995 reverse nd [ICWHO] [3]
  promoter yjiAp7 4589048 reverse nd [ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Edmonds KA., Jordan MR., Giedroc DP., 2021, COG0523 proteins: a functionally diverse family of transition metal-regulated G3E P-loop GTP hydrolases from bacteria to man., Metallomics 13(8)

 [2] Haas CE., Rodionov DA., Kropat J., Malasarn D., Merchant SS., de Crecy-Lagard V., 2009, A subset of the diverse COG0523 family of putative metal chaperones is linked to zinc homeostasis in all kingdoms of life., BMC Genomics 10:470

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB