RegulonDB RegulonDB 10.8: Gene Form
   

aceE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aceE aceF pdhR tp2 NsrR TSS_247 TSS_247 TSS_246 TSS_246 TSS_245 TSS_245 TSS_244 TSS_244 TSS_243 TSS_243 TSS_242 (cluster) TSS_242 (cluster) TSS_241 TSS_241 aceEp aceEp TSS_239 TSS_239 TSS_238 TSS_238

Gene      
Name: aceE    Texpresso search in the literature
Synonym(s): ECK0113, EG10024, b0114
Genome position(nucleotides): 123017 --> 125680 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.04
External database links:  
ASAP:
ABE-0000397
CGSC:
1050
ECHOBASE:
EB0023
OU-MICROARRAY:
b0114
PortEco:
aceE
STRING:
511145.b0114
COLOMBOS: aceE


Product      
Name: pyruvate dehydrogenase E1 component
Synonym(s): AceE, subunit of E1p component of pyruvate dehydrogenase complex
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 99.668
Isoelectric point: 5.423
Motif(s):
 
Type Positions Sequence
2 -> 887 SERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEARKGGVNVAAGTGISNYINTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLELGGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQLDNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEGIFEGAGWNVIKVMWGSRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFGKYPETAALVADWTDEQIWALNRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGDAAEGKNIAHQVKKMNMDGVRHIRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQKLHGYLPSRQPNFTEKLELPSLQDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGCSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMPAMPEGAEEGIRKGIYKLETIEGSKGKVQLLGSGSILRHVREAAEILAKDYGVGSDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQVRTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADAIAKFNIDADKVNPRLA
146 -> 146 P
276 -> 276 I
106 -> 296 GHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQLDNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEGIFEGAGWNVIKVMWG
488 -> 700 EQSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGCSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.3 - pyruvate dehydrogenase
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.21 - glyoxylate degradation
Gene Ontology Terms (GO)  
cellular_component GO:0045250 - cytosolic pyruvate dehydrogenase complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004738 - pyruvate dehydrogenase activity
GO:0004739 - pyruvate dehydrogenase (acetyl-transferring) activity
GO:0000287 - magnesium ion binding
GO:0030976 - thiamine pyrophosphate binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006096 - glycolytic process
GO:0055114 - oxidation-reduction process
Reference(s): [1] Graham LD., et al., 1989
[2] Stephens PE., et al., 1983
External database links:  
DIP:
DIP-9039N
DISPROT:
DP00427
ECOCYC:
E1P-MONOMER
ECOLIWIKI:
b0114
INTERPRO:
IPR041621
INTERPRO:
IPR035807
INTERPRO:
IPR004660
INTERPRO:
IPR029061
INTERPRO:
IPR009014
INTERPRO:
IPR005474
MINT:
MINT-1261483
PANTHER:
PTHR43825:SF3
PDB:
2QTA
PDB:
2IEA
PDB:
2QTC
PDB:
1L8A
PDB:
1RP7
PDB:
2G25
PDB:
2G28
PDB:
2G67
PFAM:
PF17831
PFAM:
PF00456
PRIDE:
P0AFG8
PRODB:
PRO_000022038
REFSEQ:
NP_414656
SMR:
P0AFG8
SWISSMODEL:
P0AFG8
UNIPROT:
P0AFG8


Operon      
Name: pdhR-aceEF-lpd         
Operon arrangement:
Transcription unit        Promoter
pdhR-aceEF-lpdA
aceEF
lpdA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR
Repressed by: NsrR, FNR, Cra, ArcA, PdhR, BtsR
Growth Conditions:

[1] 

C: Escherichia coli| multicopy plasmid pGS623 (pdhR-lpd) mutant| L broth| OD650 of 0.2
E: Escherichia coli| multicopy plasmid pGS623 (pdhR-lpd) mutant| L broth| glucose 10 mM| OD650 of 0.2

[2] 

C: Escherichia coli| multicopy plasmid pGS623 (pdhR-lpd) mutant| L broth| OD650 of 0.2
E: Escherichia coli| multicopy plasmid pGS623 (pdhR-lpd) mutant| L broth| pyruvate 40 mM| OD650 of 0.2

[3] 

C: Escherichia coli| minimal medium| succinate 40 mM
E: Escherichia coli| minimal medium| pyruvate 40 mM



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_238 122852 forward nd [RS-EPT-CBR] [3]
  promoter TSS_239 122860 forward nd [RS-EPT-CBR] [3]
  promoter TSS_241 123388 forward nd [RS-EPT-CBR] [3]
  promoter TSS_242 (cluster) 123471 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_243 124973 forward nd [RS-EPT-CBR] [3]
  promoter TSS_244 125226 forward nd [RS-EPT-CBR] [3]
  promoter TSS_245 125425 forward nd [RS-EPT-CBR] [3]
  promoter TSS_246 127432 forward nd [RS-EPT-CBR] [3]
  promoter TSS_247 127436 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Graham LD., Packman LC., Perham RN., 1989, Kinetics and specificity of reductive acylation of lipoyl domains from 2-oxo acid dehydrogenase multienzyme complexes., Biochemistry 28(4):1574-81

 [2] Stephens PE., Darlison MG., Lewis HM., Guest JR., 1983, The pyruvate dehydrogenase complex of Escherichia coli K12. Nucleotide sequence encoding the pyruvate dehydrogenase component., Eur J Biochem 133(1):155-62

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB