RegulonDB RegulonDB 10.9: Gene Form
   

agp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yccE agp yccJ CRP terminator anti-terminator anti-anti-terminator agpp agpp cbpAp6 cbpAp6

Gene      
Name: agp    Texpresso search in the literature
Synonym(s): ECK0993, EG10033, b1002
Genome position(nucleotides): 1065585 --> 1066826 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.61
Reference(s): [1] Pradel E., et al., 1989
[2] Pradel E., et al., 1988
[3] Pradel E., et al., 1990
External database links:  
ASAP:
ABE-0003388
CGSC:
31830
ECHOBASE:
EB0032
ECOLIHUB:
agp
OU-MICROARRAY:
b1002
STRING:
511145.b1002
COLOMBOS: agp


Product      
Name: glucose-1-phosphatase
Synonym(s): Agp
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 45.683
Isoelectric point: 5.461
Motif(s):
 
Type Positions Sequence
23 -> 413 QTVPEGYQLQQVLMMSRHNLRAPLANNGSVLEQSTPNKWPEWDVPGGQLTTKGGVLEVYMGHYMREWLAEQGMVKSGECPPPYTVYAYANSLQRTVATAQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEQAVAAMEKELSKLQLTDSYQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYYEGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYIDKALVTDRTSAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSKANRDLMKIEYVYQSAEQLRNADALTLQAPAQRVTLELSGCPIDADGFCPMDKFDSVLNEAVK
1 -> 22 MNKTLIAAAVAGIVLLASNAQA
311 -> 313 HDS
31 -> 363 LQQVLMMSRHNLRAPLANNGSVLEQSTPNKWPEWDVPGGQLTTKGGVLEVYMGHYMREWLAEQGMVKSGECPPPYTVYAYANSLQRTVATAQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEQAVAAMEKELSKLQLTDSYQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYYEGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYIDKALVTDRTSAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSKANRDLMKIEYVY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.9 - misc. glucose metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016787 - hydrolase activity
GO:0008877 - glucose-1-phosphatase activity
GO:0016791 - phosphatase activity
GO:0050308 - sugar-phosphatase activity
GO:0016158 - 3-phytase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006007 - glucose catabolic process
GO:0016311 - dephosphorylation
External database links:  
DIP:
DIP-2905N
ECOCYC:
GLUCOSE-1-PHOSPHAT-MONOMER
ECOLIWIKI:
b1002
INTERPRO:
IPR000560
INTERPRO:
IPR029033
INTERPRO:
IPR033379
MODBASE:
P19926
PDB:
1NT4
PDB:
6RMR
PFAM:
PF00328
PRIDE:
P19926
PRODB:
PRO_000022069
PROSITE:
PS00616
PROSITE:
PS00778
REFSEQ:
NP_415522
SMR:
P19926
UNIPROT:
P19926


Operon      
Name: agp         
Operon arrangement:
Transcription unit        Promoter
agp


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Pradel E., Boquet PL., 1989, Mapping of the Escherichia coli acid glucose-1-phosphatase gene agp and analysis of its expression in vivo by use of an agp-phoA protein fusion., J Bacteriol 171(6):3511-7

 [2] Pradel E., Boquet PL., 1988, Acid phosphatases of Escherichia coli: molecular cloning and analysis of agp, the structural gene for a periplasmic acid glucose phosphatase., J Bacteriol 170(10):4916-23

 [3] Pradel E., Marck C., Boquet PL., 1990, Nucleotide sequence and transcriptional analysis of the Escherichia coli agp gene encoding periplasmic acid glucose-1-phosphatase., J Bacteriol 172(2):802-7


RegulonDB