RegulonDB RegulonDB 10.10: Gene Form
   

argA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: argA    Texpresso search in the literature
Synonym(s): Arg1, Arg2, ECK2814, EG10063, b2818
Genome position(nucleotides): 2949242 --> 2950573 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.55
External database links:  
ASAP:
ABE-0009245
CGSC:
1021
ECHOBASE:
EB0061
ECOLIHUB:
argA
NCBI-GENE:
947289
OU-MICROARRAY:
b2818
STRING:
511145.b2818
COLOMBOS: argA


Product      
Name: N-acetylglutamate synthase
Synonym(s): ArgA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.195
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
54 -> 54 S
15 -> 15 H
58 -> 58 R
19 -> 19 Y
336 -> 413 KFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0103045 - methione N-acyltransferase activity
GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - acyltransferase activity
GO:0004042 - acetyl-CoA:L-glutamate N-acetyltransferase activity
GO:0042802 - identical protein binding
GO:0004358 - glutamate N-acetyltransferase activity
biological_process GO:0006526 - arginine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
External database links:  
DIP:
DIP-48037N
ECOCYC:
N-ACETYLTRANSFER-MONOMER
ECOLIWIKI:
b2818
INTERPRO:
IPR036393
INTERPRO:
IPR033719
INTERPRO:
IPR016181
INTERPRO:
IPR010167
INTERPRO:
IPR001048
INTERPRO:
IPR000182
MODBASE:
P0A6C5
PANTHER:
PTHR30602
PFAM:
PF00583
PFAM:
PF00696
PRIDE:
P0A6C5
PRODB:
PRO_000022126
PROSITE:
PS51186
REFSEQ:
NP_417295
SMR:
P0A6C5
UNIPROT:
P0A6C5


Operon      
Name: argA         
Operon arrangement:
Transcription unit        Promoter
argA


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3126 2949064 reverse nd [RS-EPT-CBR] [1]
  promoter amiCp7 2949066 reverse nd [ICWHO] [2]
  promoter amiCp6 2949189 reverse nd [ICWHO] [2]
  promoter TSS_3127 2951765 reverse nd [RS-EPT-CBR] [1]



RegulonDB