RegulonDB RegulonDB 10.9: Gene Form
   

argC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

argE argC argB ArgR ArgR argEp2 argEp2 argEp1 argEp1 TSS_4685 TSS_4685 argCp argCp TSS_4684 (cluster) TSS_4684 (cluster) TSS_4683 TSS_4683

Gene      
Name: argC    Texpresso search in the literature
Synonym(s): Arg2, ECK3949, EG10065, b3958
Genome position(nucleotides): 4155001 --> 4156005 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.53
External database links:  
ASAP:
ABE-0012964
CGSC:
1019
ECHOBASE:
EB0063
ECOLIHUB:
argC
NCBI-GENE:
948455
OU-MICROARRAY:
b3958
STRING:
511145.b3958
COLOMBOS: argC


Product      
Name: N-acetylglutamylphosphate reductase
Synonym(s): ArgC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.952
Isoelectric point: 5.893
Motif(s):
 
Type Positions Sequence
163 -> 311 LKPLIDADLLDLNQWPVINATSGVSGAGRKAAISNSFCEVSLQPYGVFTHRHQPEIATHLGADVIFTPHLGNFPRGILETITCRLKSGVTQAQVAQVLQQAYAHKPLVRLYDKGVPALKNVVGLPFCDIGFAVQGEHLIIVATEDNLLK
5 -> 145 LIVGASGYAGAELVTYVNRHPHMNITALTVSAQSNDAGKLISDLHPQLKGIVDLPLQPMSDISEFSPGVDVVFLATAHEVSHDLAPQFLEAGCVVFDLSGAFRVNDATFYEKYYGFTHQYPELLEQAAYGLAEWCGNKLKE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0003942 - N-acetyl-gamma-glutamyl-phosphate reductase activity
GO:0046983 - protein dimerization activity
GO:0051287 - NAD binding
biological_process GO:0006526 - arginine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
N-ACETYLGLUTPREDUCT-MONOMER
ECOLIWIKI:
b3958
INTERPRO:
IPR000706
INTERPRO:
IPR036291
INTERPRO:
IPR023013
INTERPRO:
IPR000534
INTERPRO:
IPR012280
MODBASE:
P11446
PFAM:
PF01118
PFAM:
PF02774
PRIDE:
P11446
PROSITE:
PS01224
REFSEQ:
NP_418393
SMART:
SM00859
SMR:
P11446
SWISSMODEL:
P11446
UNIPROT:
P11446


Operon      
Name: argCBH         
Operon arrangement:
Transcription unit        Promoter
argCBH
argH


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4683 4153697 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4684 (cluster) 4154883 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4685 4154887 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB