RegulonDB RegulonDB 10.9: Gene Form
   

argI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjgL argI rraB ArgR ArgR DksA-ppGpp DksA-ppGpp ppGpp rraBp2 rraBp2 rraBp1 rraBp1 argIp argIp

Gene      
Name: argI    Texpresso search in the literature
Synonym(s): ECK4247, EG10069, b4254
Genome position(nucleotides): 4477307 <-- 4478311 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.14
External database links:  
ASAP:
ABE-0013927
CGSC:
1013
ECHOBASE:
EB0067
ECOLIHUB:
argI
MIM:
311250
NCBI-GENE:
948774
OU-MICROARRAY:
b4254
STRING:
511145.b4254
COLOMBOS: argI


Product      
Name: ornithine carbamoyltransferase ArgI
Synonym(s): ArgI, ornithine carbamoyltransferase chain I
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.907
Isoelectric point: 5.436
Motif(s):
 
Type Positions Sequence
7 -> 147 KHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEAKLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYASVPVWNGLTNEFHPTQLLADLLTMQE
134 -> 137 HPTQ
121 -> 121 A
156 -> 330 EMTLVYAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEAALVTECRALAQQNGGNITLTEDVAKGVEGADFIYTDVWVSMGEAKEKWAERIALLREYQVNSKMMQLTGNPEVKFLHCLPAFHDDQTTLGKKMAEEFGLHGGMEVTDEVFESAASIVFDQAENRMHTIKAVMVA
58 -> 58 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016597 - amino acid binding
GO:0016743 - carboxyl- or carbamoyltransferase activity
GO:0004585 - ornithine carbamoyltransferase activity
biological_process GO:0019240 - citrulline biosynthetic process
GO:0008152 - metabolic process
GO:0006520 - cellular amino acid metabolic process
GO:0006526 - arginine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0006591 - ornithine metabolic process
GO:0042450 - arginine biosynthetic process via ornithine
External database links:  
DIP:
DIP-9143N
ECOCYC:
CHAINI-MONOMER
ECOLIWIKI:
b4254
INTERPRO:
IPR036901
INTERPRO:
IPR024904
INTERPRO:
IPR002292
INTERPRO:
IPR006131
INTERPRO:
IPR006132
INTERPRO:
IPR006130
MODBASE:
P04391
PDB:
2OTC
PDB:
1DUV
PDB:
1AKM
PFAM:
PF00185
PFAM:
PF02729
PRIDE:
P04391
PRINTS:
PR00100
PRINTS:
PR00102
PRODB:
PRO_000022131
PROSITE:
PS00097
REFSEQ:
NP_418675
SMR:
P04391
UNIPROT:
P04391


Operon      
Name: argI         
Operon arrangement:
Transcription unit        Promoter
argI


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB