RegulonDB RegulonDB 10.9: Gene Form
   

argR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdh argR yhcN ArgR ArgR BtsR BtsR CRP BtsR ArcA TSS_3573 TSS_3573 yhcNp6 yhcNp6 yhcNp5 yhcNp5 argRp1 argRp1 argRp2 argRp2 TSS_3572 TSS_3572 mdhp2 mdhp2 TSS_3571 TSS_3571 mdhp1 mdhp1 TSS_3570 (cluster) TSS_3570 (cluster) TSS_3569 TSS_3569

Gene      
Name: argR    Texpresso search in the literature
Synonym(s): ECK3226, EG10070, Rarg, b3237, xerA
Genome position(nucleotides): 3384703 --> 3385173 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.62
External database links:  
ASAP:
ABE-0010620
CGSC:
1011
ECHOBASE:
EB0068
ECOLIHUB:
argR
OU-MICROARRAY:
b3237
STRING:
511145.b3237
COLOMBOS: argR


Product      
Name: DNA-binding transcriptional dual regulator ArgR
Synonym(s): ArgR, XerA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: ArgR
Cellular location: cytosol
Molecular weight: 16.994
Isoelectric point: 4.66
Motif(s):
 
Type Positions Sequence
82 -> 148 LKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKDLYEAI
5 -> 74 AKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMVYCLPAELG
44 -> 44 S
47 -> 47 S
76 -> 76 P

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005667 - transcription regulator complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0042802 - identical protein binding
GO:0034618 - arginine binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:1900079 - regulation of arginine biosynthetic process
GO:1900081 - regulation of arginine catabolic process
GO:0006310 - DNA recombination
GO:0006355 - regulation of transcription, DNA-templated
GO:0006525 - arginine metabolic process
GO:0006526 - arginine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0051259 - protein complex oligomerization
GO:0042150 - plasmid recombination
GO:2000143 - negative regulation of DNA-templated transcription, initiation
GO:2000144 - positive regulation of DNA-templated transcription, initiation
Reference(s): [1] Krzyzek R., et al., 1972
[2] Lim DB., et al., 1987
[3] Stirling CJ., et al., 1988
[4] Tian G., et al., 1994
External database links:  
DIP:
DIP-47999N
ECOCYC:
PD00194
ECOLIWIKI:
b3237
INTERPRO:
IPR020900
INTERPRO:
IPR001669
INTERPRO:
IPR020899
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR036251
MODBASE:
P0A6D0
PANTHER:
PTHR34471
PDB:
1XXC
PDB:
1XXB
PDB:
1XXA
PDB:
1AOY
PFAM:
PF01316
PFAM:
PF02863
PRIDE:
P0A6D0
PRINTS:
PR01467
PRODB:
PRO_000022134
REFSEQ:
NP_417704
SMR:
P0A6D0
UNIPROT:
P0A6D0


Operon      
Name: argR         
Operon arrangement:
Transcription unit        Promoter
argR
argR


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3569 3384285 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3570 (cluster) 3384294 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_3571 3384314 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3572 3384472 reverse nd [RS-EPT-CBR] [5]
  promoter yhcNp5 3385406 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter yhcNp6 3385481 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter TSS_3573 3385482 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Krzyzek R., Rogers P., 1972, Arginine control of transcription of argECBH messenger ribonucleic acid in Escherichia coli., J Bacteriol 110(3):945-54

 [2] Lim DB., Oppenheim JD., Eckhardt T., Maas WK., 1987, Nucleotide sequence of the argR gene of Escherichia coli K-12 and isolation of its product, the arginine repressor., Proc Natl Acad Sci U S A 84(19):6697-701

 [3] Stirling CJ., Szatmari G., Stewart G., Smith MC., Sherratt DJ., 1988, The arginine repressor is essential for plasmid-stabilizing site-specific recombination at the ColE1 cer locus., EMBO J 7(13):4389-95

 [4] Tian G., Maas WK., 1994, Mutational analysis of the arginine repressor of Escherichia coli., Mol Microbiol 13(4):599-608

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB