RegulonDB RegulonDB 10.9: Gene Form
   

aroD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydiF ydiB aroD aroDp aroDp

Gene      
Name: aroD    Texpresso search in the literature
Synonym(s): ECK1691, EG10076, b1693
Genome position(nucleotides): 1774686 --> 1775444 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.46
External database links:  
ASAP:
ABE-0005653
CGSC:
1005
ECHOBASE:
EB0074
ECOLIHUB:
aroD
OU-MICROARRAY:
b1693
STRING:
511145.b1693
COLOMBOS: aroD


Product      
Name: 3-dehydroquinate dehydratase
Synonym(s): AroD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.467
Isoelectric point: 5.016
Motif(s):
 
Type Positions Sequence
143 -> 143 H
170 -> 170 K
20 -> 246 VSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVL
205 -> 205 M
46 -> 48 EWR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.20 - chorismate
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0003855 - 3-dehydroquinate dehydratase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009073 - aromatic amino acid family biosynthetic process
GO:0009423 - chorismate biosynthetic process
GO:0046279 - 3,4-dihydroxybenzoate biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
AROD-MONOMER
ECOLIWIKI:
b1693
INTERPRO:
IPR018508
INTERPRO:
IPR013785
INTERPRO:
IPR001381
MODBASE:
P05194
PFAM:
PF01487
PRIDE:
P05194
PRODB:
PRO_000022145
PROSITE:
PS01028
REFSEQ:
NP_416208
SMR:
P05194
SWISSMODEL:
P05194
UNIPROT:
P05194


Operon      
Name: ydiNB-aroD         
Operon arrangement:
Transcription unit        Promoter
aroD
ydiNB-aroD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB