RegulonDB RegulonDB 10.9: Gene Form
   

aslB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aslA aslB proM terminator anti-terminator anti-anti-terminator aslBp aslBp

Gene      
Name: aslB    Texpresso search in the literature
Synonym(s): ECK3793, EG10090, atsB, b3800, gppB
Genome position(nucleotides): 3982958 --> 3984193 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.67
External database links:  
ASAP:
ABE-0012408
CGSC:
33960
ECHOBASE:
EB0088
ECOLIHUB:
aslB
OU-MICROARRAY:
b3800
STRING:
511145.b3800
COLOMBOS: aslB


Product      
Name: putative anaerobic sulfatase maturation enzyme AslB
Synonym(s): AslB, AtsB, GppB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.513
Isoelectric point: 6.956
Motif(s):
 
Type Positions Sequence
3 -> 250 QQVPTRAFHVMAKPSGSDCNLNCDYCFYLEKQSLYREKPVTHMDDDTLEAYVRHYIAASEPQNEVAFTWQGGEPTLLGLAFYRRAVALQAKYGAGRKISNSFQTNGVLLDDEWCAFLAEHHFLVGLSLDGPPEIHNQYRVTKGGRPTHKLVMRALTLLQKHHVDYNVLVCVNRTSAQQPLQVYDFLCDAGVEFIQFIPVVERLADETTARDGLKLHAPGDIQGELTEWSVRPEEFGEFLVAIFDHWIK
116 -> 117 CA
282 -> 343 CGRSVIVEHNGDVYACDHYVYPQYRLGNMHQQTIAEMIDSPQQQAFGEDKFKQLPAQCRSCN
19 -> 173 SDCNLNCDYCFYLEKQSLYREKPVTHMDDDTLEAYVRHYIAASEPQNEVAFTWQGGEPTLLGLAFYRRAVALQAKYGAGRKISNSFQTNGVLLDDEWCAFLAEHHFLVGLSLDGPPEIHNQYRVTKGGRPTHKLVMRALTLLQKHHVDYNVLVCV
391 -> 391 L

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0051604 - protein maturation
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Berteau O., et al., 2006
External database links:  
ECOCYC:
EG10090-MONOMER
ECOLIWIKI:
b3800
INTERPRO:
IPR023885
INTERPRO:
IPR013785
INTERPRO:
IPR007197
INTERPRO:
IPR034491
MODBASE:
P25550
PFAM:
PF13353
PFAM:
PF13186
PFAM:
PF04055
PRIDE:
P25550
PROSITE:
PS51918
REFSEQ:
YP_026259
SMR:
P25550
UNIPROT:
P25550


Operon      
Name: aslB         
Operon arrangement:
Transcription unit        Promoter
aslB


Transcriptional Regulation      
Display Regulation             
Activated by: GadE-RcsB, Rob


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Berteau O., Guillot A., Benjdia A., Rabot S., 2006, A new type of bacterial sulfatase reveals a novel maturation pathway in prokaryotes., J Biol Chem 281(32):22464-70


RegulonDB