RegulonDB RegulonDB 11.0: Gene Form
   

asnA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

viaA asnA asnC ravA AsnC Nac AsnC AsnC Nac AsnC Nac anti-anti-terminator anti-terminator terminator terminator TSS_4354 TSS_4354 TSS_4353 TSS_4353 TSS_4352 TSS_4352 TSS_4351 TSS_4351 TSS_4350 TSS_4350 TSS_4349 (cluster) TSS_4349 (cluster) asnAp asnAp asnCp asnCp

Gene      
Name: asnA    Texpresso search in the literature
Synonym(s): ECK3738, EG10091, b3744
Genome position(nucleotides): 3927155 --> 3928147
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.5
Reference(s): [1] Nakamura M., et al., 1981
External database links:  
ASAP:
ABE-0012242
CGSC:
995
ECHOBASE:
EB0089
ECOLIHUB:
asnA
OU-MICROARRAY:
b3744
STRING:
511145.b3744
COLOMBOS: asnA


Product      
Name: asparagine synthetase A
Synonym(s): AsnA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.651
Isoelectric point: 5.55
Motif(s):
 
Type Positions Sequence Comment
9 -> 244 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.6 - asparagine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004071 - aspartate-ammonia ligase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006529 - asparagine biosynthetic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0008652 - cellular amino acid biosynthetic process
GO:0070981 - L-asparagine biosynthetic process
External database links:  
ALPHAFOLD:
P00963
DIP:
DIP-9176N
ECOCYC:
ASNSYNA-MONOMER
ECOLIWIKI:
b3744
INTERPRO:
IPR004618
INTERPRO:
IPR006195
MODBASE:
P00963
PANTHER:
PTHR30073
PDB:
11AS
PDB:
12AS
PFAM:
PF03590
PRIDE:
P00963
PRODB:
PRO_000022167
PROSITE:
PS50862
REFSEQ:
NP_418200
SMR:
P00963
UNIPROT:
P00963


Operon      
Name: asnA         
Operon arrangement:
Transcription unit        Promoter
asnA


Transcriptional Regulation      
Display Regulation             
Activated by: AsnC


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4349 (cluster) 3927131 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4350 3927138 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4351 3927155 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4352 3927521 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4353 3928691 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4354 3928821 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nakamura M., Yamada M., Hirota Y., Sugimoto K., Oka A., Takanami M., 1981, Nucleotide sequence of the asnA gene coding for asparagine synthetase of E. coli K-12., Nucleic Acids Res 9(18):4669-76

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB